DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1523 and AT1G10580

DIOPT Version :9

Sequence 1:NP_651635.2 Gene:CG1523 / 43400 FlyBaseID:FBgn0039601 Length:621 Species:Drosophila melanogaster
Sequence 2:NP_172528.2 Gene:AT1G10580 / 837599 AraportID:AT1G10580 Length:573 Species:Arabidopsis thaliana


Alignment Length:324 Identity:66/324 - (20%)
Similarity:113/324 - (34%) Gaps:91/324 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 YSSMNMFN-----SYHANCW---PTDAGRTGAIFNLEFNADGNVVVAATERKCVLVFDAITQKEI 83
            |:..:.|:     .|....|   |.||                   .|....|.:      .|.:
plant   235 YADKSTFHGKEEKDYQGRSWIEAPKDA-------------------KANNDHCYI------PKRL 274

  Fly    84 FKVPDAHTDSVNCIKFFDER--LFATGSDDFTVALWDLRNMKQKLRVLHGHSNWVKNIEYSSKDK 146
            ......||..|:.|:||.::  |..:...|..|.:||:.|..:.:|...||:..|::|.:|:...
plant   275 VHTWSGHTKGVSAIRFFPKQGHLLLSAGMDCKVKIWDVYNSGKCMRTYMGHAKAVRDICFSNDGS 339

  Fly   147 LLVSSGFDGSIFTWDINSQTEQGLISQRVFHASGLMRCRISPTGDKLVLCTSGGYIMIIHHLDLT 211
            ..:::|:|.:|..||    ||.|.:.............:::|..||..:..:|.....|...|:.
plant   340 KFLTAGYDKNIKYWD----TETGQVISTFSTGKIPYVVKLNPDDDKQNILLAGMSDKKIVQWDIN 400

  Fly   212 TLHKDLCGFRPGIYRLMQLGEQYIPQAAKYDHVFSKRQKKNRVELVTDFPENN-------DAEMI 269
            |                  ||  :.|  :||      |....|..:| |.:||       |.:.:
plant   401 T------------------GE--VTQ--EYD------QHLGAVNTIT-FVDNNRRFVTSSDDKSL 436

  Fly   270 MALQI----------HPHCCCMLTRNVSCDEQSEWTCIHDI-NEEPVRSEDEQDEVEPQPKRKR 322
            ...:.          .||...|  .::|......|.....: |:..:.|..|:.::.   |:||
plant   437 RVWEFGIPVVIKYISEPHMHSM--PSISVHPNGNWLAAQSLDNQILIYSTRERFQLN---KKKR 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1523NP_651635.2 WD40 43..235 CDD:295369 40/193 (21%)
WD40 <45..>218 CDD:225201 37/174 (21%)
WD40 repeat 51..87 CDD:293791 3/35 (9%)
WD40 repeat 95..129 CDD:293791 10/35 (29%)
WD40 repeat 136..174 CDD:293791 11/37 (30%)
WD40 repeat 181..210 CDD:293791 5/28 (18%)
AT1G10580NP_172528.2 WD40 <271..573 CDD:225201 57/263 (22%)
WD40 274..573 CDD:238121 56/260 (22%)
WD40 repeat 285..324 CDD:293791 11/38 (29%)
WD40 repeat 330..367 CDD:293791 10/40 (25%)
WD40 repeat 372..409 CDD:293791 10/58 (17%)
WD40 repeat 416..451 CDD:293791 5/35 (14%)
WD40 repeat 458..497 CDD:293791 9/43 (21%)
WD40 repeat 505..541 CDD:293791
WD40 repeat 547..572 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.