DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1523 and GRWD1

DIOPT Version :9

Sequence 1:NP_651635.2 Gene:CG1523 / 43400 FlyBaseID:FBgn0039601 Length:621 Species:Drosophila melanogaster
Sequence 2:NP_113673.3 Gene:GRWD1 / 83743 HGNCID:21270 Length:446 Species:Homo sapiens


Alignment Length:185 Identity:41/185 - (22%)
Similarity:70/185 - (37%) Gaps:40/185 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 DDNSLMRRIYSSMNMFNSYHANCW---------------------PTD-----------AGRTGA 50
            |:.:.|:.|:|.........|..|                     |||           .|.|.:
Human   199 DEQAQMKPIFSFAGHMGEGFALDWSPRVTGRLLTGDCQKNIHLWTPTDGGSWHVDQRPFVGHTRS 263

  Fly    51 IFNLEFNADGNVVVAATERKC-VLVFD---AITQKEIFKVPDAHTDSVNCIKFF-DERLFATGSD 110
            :.:|:::...|.|.|:..... :.::|   |.::..:.....||...||.|.:. .|....:|.|
Human   264 VEDLQWSPTENTVFASCSADASIRIWDIRAAPSKACMLTTATAHDGDVNVISWSRREPFLLSGGD 328

  Fly   111 DFTVALWDLRNMK--QKLRVLHGHSNWVKNIEYSSKDK-LLVSSGFDGSIFTWDI 162
            |..:.:||||..|  ..:.....|...|.::|:..:|. :..:||.|..|..||:
Human   329 DGALKIWDLRQFKSGSPVATFKQHVAPVTSVEWHPQDSGVFAASGADHQITQWDL 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1523NP_651635.2 WD40 43..235 CDD:295369 34/139 (24%)
WD40 <45..>218 CDD:225201 32/126 (25%)
WD40 repeat 51..87 CDD:293791 6/39 (15%)
WD40 repeat 95..129 CDD:293791 11/36 (31%)
WD40 repeat 136..174 CDD:293791 9/28 (32%)
WD40 repeat 181..210 CDD:293791
GRWD1NP_113673.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..38
CAF1C_H4-bd 44..111 CDD:289068
WD 1 54..110
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 110..141
WD 2 163..204 1/4 (25%)
WD40 <197..>383 CDD:225201 40/183 (22%)
WD40 204..>384 CDD:295369 40/180 (22%)
WD 3 205..250 7/44 (16%)
WD40 repeat 218..259 CDD:293791 5/40 (13%)
WD 4 251..297 8/45 (18%)
WD40 repeat 265..306 CDD:293791 6/40 (15%)
WD 5 298..343 14/44 (32%)
WD40 repeat 311..350 CDD:293791 12/38 (32%)
WD 6 344..405 10/40 (25%)
WD 7 406..442
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.