DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1523 and AT3G18950

DIOPT Version :9

Sequence 1:NP_651635.2 Gene:CG1523 / 43400 FlyBaseID:FBgn0039601 Length:621 Species:Drosophila melanogaster
Sequence 2:NP_188525.1 Gene:AT3G18950 / 821427 AraportID:AT3G18950 Length:473 Species:Arabidopsis thaliana


Alignment Length:181 Identity:41/181 - (22%)
Similarity:79/181 - (43%) Gaps:33/181 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 AIFNLEFNADGNVVVAATERKCVLVFDAITQKEIFKVPDAHTDSVNCIKF-FDERLFATGSDDFT 113
            |:..|..|.:..::.:.:..|.:.|: .::..:..:...||.|::|.:.. ||:.|| |||.|.|
plant   251 AVSCLSLNEELGLLYSGSWDKTLKVW-RLSDSKCLESIQAHDDAINTVAAGFDDLLF-TGSADGT 313

  Fly   114 VALWDLRNMKQK------LRVLHGHSNWVKNIEYSSKDKLLVSSGFDGSIFTWDINSQTEQGLIS 172
            :.:|. |.::.|      :.||....|.|..:..:....::.....||::..|:          .
plant   314 LKVWK-RELQGKGTKHFLVNVLMKQENAVTALAVNITAAVVYCGSSDGTVNFWE----------G 367

  Fly   173 QRVFHASGLMRCRISPTGDKL-VLC-TSGGYIMIIHHLDLTTLHKDLCGFR 221
            |:.....|.:|      |.:| ||| .:.|.:::....|     |::|.:|
plant   368 QKYLSHGGTLR------GHRLAVLCLAAAGSLVLSGGAD-----KNICVWR 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1523NP_651635.2 WD40 43..235 CDD:295369 41/181 (23%)
WD40 <45..>218 CDD:225201 39/176 (22%)
WD40 repeat 51..87 CDD:293791 4/35 (11%)
WD40 repeat 95..129 CDD:293791 13/40 (33%)
WD40 repeat 136..174 CDD:293791 4/37 (11%)
WD40 repeat 181..210 CDD:293791 7/30 (23%)
AT3G18950NP_188525.1 WD40 130..463 CDD:295369 41/181 (23%)
WD40 146..>472 CDD:225201 41/181 (23%)
WD40 repeat 179..245 CDD:293791
WD40 repeat 253..288 CDD:293791 4/35 (11%)
WD40 repeat 294..330 CDD:293791 13/37 (35%)
WD40 repeat 341..378 CDD:293791 6/46 (13%)
WD40 repeat 384..406 CDD:293791 7/26 (27%)
WD40 repeat 427..462 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4155
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.