DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1523 and WDR55

DIOPT Version :9

Sequence 1:NP_651635.2 Gene:CG1523 / 43400 FlyBaseID:FBgn0039601 Length:621 Species:Drosophila melanogaster
Sequence 2:NP_565782.1 Gene:WDR55 / 817987 AraportID:AT2G34260 Length:353 Species:Arabidopsis thaliana


Alignment Length:194 Identity:48/194 - (24%)
Similarity:88/194 - (45%) Gaps:23/194 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 HIHRSD-DNSLMRRIYSSMNMFNSYHANCWPTDAGRTGAIFNLEFNADGNVVVAATERKCVLVFD 76
            |::|.| |:||:|.     ....::..:|..           :.|..||..:|.|:....:|..|
plant    31 HLYRYDSDSSLVRE-----RKVRAHKESCRA-----------VRFIDDGQRIVTASADCSILATD 79

  Fly    77 AITQKEIFKVPDAHTDSVNCIKFFDERLFATGSDDFTVALWDLRNMKQKLRVLHGHSNWVKNIEY 141
            ..|..::..:.:||.|:||.:....|...|:|.|...|.:||.| .:......:.|.:::..:.:
plant    80 VETGAQVAHLENAHEDAVNTLINVTETTIASGDDKGCVKIWDTR-QRSCSHEFNAHEDYISGMTF 143

  Fly   142 SSKD-KLLVSSGFDGSIFTWDINSQTEQGLISQRVFHASGLMRCRISPTGDKLVLCTSGGYIMI 204
            :|.. ||:|:|| ||::...::.:...|   ||..|....|:...|...|.|::..|..|.:::
plant   144 ASDSMKLVVTSG-DGTLSVCNLRTSKVQ---SQSEFSEDELLSVVIMKNGRKVICGTQNGTLLL 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1523NP_651635.2 WD40 43..235 CDD:295369 40/163 (25%)
WD40 <45..>218 CDD:225201 40/161 (25%)
WD40 repeat 51..87 CDD:293791 8/35 (23%)
WD40 repeat 95..129 CDD:293791 9/33 (27%)
WD40 repeat 136..174 CDD:293791 10/38 (26%)
WD40 repeat 181..210 CDD:293791 6/24 (25%)
WDR55NP_565782.1 WD40 12..290 CDD:392136 48/194 (25%)
WD40 repeat 12..49 CDD:293791 7/22 (32%)
WD40 repeat 54..90 CDD:293791 9/46 (20%)
WD40 repeat 98..132 CDD:293791 9/34 (26%)
WD40 repeat 138..176 CDD:293791 11/41 (27%)
WD40 repeat 224..246 CDD:293791
WD40 repeat 265..289 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.