DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1523 and AT2G19540

DIOPT Version :9

Sequence 1:NP_651635.2 Gene:CG1523 / 43400 FlyBaseID:FBgn0039601 Length:621 Species:Drosophila melanogaster
Sequence 2:NP_179544.1 Gene:AT2G19540 / 816473 AraportID:AT2G19540 Length:469 Species:Arabidopsis thaliana


Alignment Length:224 Identity:60/224 - (26%)
Similarity:95/224 - (42%) Gaps:61/224 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 WPTD----AGRTGAIFNLEFN-ADGNVVVAATERKCVLVFDAITQKE---IFKVPDAHTDSVNCI 97
            |..|    ||.|.::.:|::: |:.||..:.:....|.|:|....|.   .||   ||...||.|
plant   258 WAVDPIPFAGHTASVEDLQWSPAEENVFASCSVDGSVAVWDIRLGKSPALSFK---AHNADVNVI 319

  Fly    98 KFFDERL----FATGSDDFTVALWDLRNMKQKLRVL---HGHSNWVKNIEYSSKD--KLLVSSGF 153
            .:  .||    .|:||||.|.::.|||.:|....|:   ..|.:.:.:||:|:.:  .|.|:|| 
plant   320 SW--NRLASCMLASGSDDGTFSIRDLRLIKGGDAVVAHFEYHKHPITSIEWSAHEASTLAVTSG- 381

  Fly   154 DGSIFTWDI------------NSQTE------QGLISQRVFHASGLMRCR------------ISP 188
            |..:..||:            |:||:      |.|..|.:|...|....:            ||.
plant   382 DNQLTIWDLSLEKDEEEEAEFNAQTKELVNTPQDLPPQLLFVHQGQKDLKELHWHNQIPGMIIST 446

  Fly   189 TGDKLVLCTSGGYIMIIHHLDLTTLHKDL 217
            .||        |:.:::.:....||..:|
plant   447 AGD--------GFNILMPYNIQNTLPSEL 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1523NP_651635.2 WD40 43..235 CDD:295369 59/222 (27%)
WD40 <45..>218 CDD:225201 58/216 (27%)
WD40 repeat 51..87 CDD:293791 10/39 (26%)
WD40 repeat 95..129 CDD:293791 14/37 (38%)
WD40 repeat 136..174 CDD:293791 15/57 (26%)
WD40 repeat 181..210 CDD:293791 5/40 (13%)
AT2G19540NP_179544.1 CAF1C_H4-bd 42..108 CDD:289068
WD40 <157..>392 CDD:225201 44/139 (32%)
WD40 158..>391 CDD:295369 44/138 (32%)
WD40 repeat 163..221 CDD:293791
WD40 repeat 226..264 CDD:293791 2/5 (40%)
WD40 repeat 273..309 CDD:293791 8/35 (23%)
WD40 repeat 316..357 CDD:293791 16/42 (38%)
WD40 repeat 363..390 CDD:293791 9/27 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.