DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1523 and FVE

DIOPT Version :9

Sequence 1:NP_651635.2 Gene:CG1523 / 43400 FlyBaseID:FBgn0039601 Length:621 Species:Drosophila melanogaster
Sequence 2:NP_565456.2 Gene:FVE / 816471 AraportID:AT2G19520 Length:507 Species:Arabidopsis thaliana


Alignment Length:207 Identity:50/207 - (24%)
Similarity:80/207 - (38%) Gaps:43/207 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 CVLVFDAIT-QKEIFKVPDAHTDSVNCIKF--FDERLFATGSDDFTVALWDLRNMK-----QKLR 127
            |::::||.| ...:.||..||...::|:.:  .|:.|..|||.|.||.|:|.|.:.     ..:.
plant   316 CLILWDARTGTNPVTKVEKAHDADLHCVDWNPHDDNLILTGSADNTVRLFDRRKLTANGVGSPIY 380

  Fly   128 VLHGHSNWVKNIEYS-SKDKLLVSSGFDGSIFTWDIN---------SQTEQGLISQRV------- 175
            ...||...|..:::| .|..:..||..||.:..||.:         :::..||..|..       
plant   381 KFEGHKAAVLCVQWSPDKSSVFGSSAEDGLLNIWDYDRVSKKSDRAAKSPAGLFFQHAGHRDKVV 445

  Fly   176 -FHASGLMRCRISPTGDKLVLCTSGGYIMIIHHLDLTTLHKDLCGFRPGIYRLMQLGEQYIPQAA 239
             ||.:......|....|.......||.:.|....||.        :||        .|:.:.:..
plant   446 DFHWNASDPWTIVSVSDDCETTGGGGTLQIWRMSDLI--------YRP--------EEEVVAELE 494

  Fly   240 KY-DHVFSKRQK 250
            |: .||.:...|
plant   495 KFKSHVMTCASK 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1523NP_651635.2 WD40 43..235 CDD:295369 46/189 (24%)
WD40 <45..>218 CDD:225201 43/172 (25%)
WD40 repeat 51..87 CDD:293791 5/16 (31%)
WD40 repeat 95..129 CDD:293791 12/40 (30%)
WD40 repeat 136..174 CDD:293791 11/47 (23%)
WD40 repeat 181..210 CDD:293791 5/28 (18%)
FVENP_565456.2 CAF1C_H4-bd 66..134 CDD:403473
WD40 163..477 CDD:421866 41/160 (26%)
WD40 repeat 168..217 CDD:293791
WD40 repeat 222..289 CDD:293791
WD40 repeat 296..333 CDD:293791 5/16 (31%)
WD40 repeat 340..383 CDD:293791 12/42 (29%)
WD40 repeat 389..438 CDD:293791 12/48 (25%)
WD40 repeat 444..476 CDD:293791 6/31 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.