Sequence 1: | NP_651635.2 | Gene: | CG1523 / 43400 | FlyBaseID: | FBgn0039601 | Length: | 621 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_565456.2 | Gene: | FVE / 816471 | AraportID: | AT2G19520 | Length: | 507 | Species: | Arabidopsis thaliana |
Alignment Length: | 207 | Identity: | 50/207 - (24%) |
---|---|---|---|
Similarity: | 80/207 - (38%) | Gaps: | 43/207 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 71 CVLVFDAIT-QKEIFKVPDAHTDSVNCIKF--FDERLFATGSDDFTVALWDLRNMK-----QKLR 127
Fly 128 VLHGHSNWVKNIEYS-SKDKLLVSSGFDGSIFTWDIN---------SQTEQGLISQRV------- 175
Fly 176 -FHASGLMRCRISPTGDKLVLCTSGGYIMIIHHLDLTTLHKDLCGFRPGIYRLMQLGEQYIPQAA 239
Fly 240 KY-DHVFSKRQK 250 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG1523 | NP_651635.2 | WD40 | 43..235 | CDD:295369 | 46/189 (24%) |
WD40 | <45..>218 | CDD:225201 | 43/172 (25%) | ||
WD40 repeat | 51..87 | CDD:293791 | 5/16 (31%) | ||
WD40 repeat | 95..129 | CDD:293791 | 12/40 (30%) | ||
WD40 repeat | 136..174 | CDD:293791 | 11/47 (23%) | ||
WD40 repeat | 181..210 | CDD:293791 | 5/28 (18%) | ||
FVE | NP_565456.2 | CAF1C_H4-bd | 66..134 | CDD:403473 | |
WD40 | 163..477 | CDD:421866 | 41/160 (26%) | ||
WD40 repeat | 168..217 | CDD:293791 | |||
WD40 repeat | 222..289 | CDD:293791 | |||
WD40 repeat | 296..333 | CDD:293791 | 5/16 (31%) | ||
WD40 repeat | 340..383 | CDD:293791 | 12/42 (29%) | ||
WD40 repeat | 389..438 | CDD:293791 | 12/48 (25%) | ||
WD40 repeat | 444..476 | CDD:293791 | 6/31 (19%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |