DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1523 and Wdr55

DIOPT Version :9

Sequence 1:NP_651635.2 Gene:CG1523 / 43400 FlyBaseID:FBgn0039601 Length:621 Species:Drosophila melanogaster
Sequence 2:NP_080740.2 Gene:Wdr55 / 67936 MGIID:1915186 Length:388 Species:Mus musculus


Alignment Length:151 Identity:34/151 - (22%)
Similarity:69/151 - (45%) Gaps:4/151 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 FNADGNVVVAATERKCVLVFDAITQKEIFKVPDAHTDSVNCIKFFDERLFATGSDDFTVALWDLR 120
            |:.||..:|..::.|.:.:.|....:...::..||:..:|.:...||....||.|...:.|||.|
Mouse    93 FSEDGQKLVTVSKDKAIHILDVEQGQLERRISKAHSAPINSVLLVDENALVTGDDTGGIRLWDQR 157

  Fly   121 NMKQKLRVLHGHSNWVKNIEYSSKDKLLVSSGFDGSIFTWDINSQTEQGLISQRVFHASGLMRCR 185
            . :..|..:..|..::.::......|||:::..||.:..::|..:..: |:|:.  .:..|....
Mouse   158 K-EGPLMDMRQHEEYIADMALDPAKKLLLTASGDGCLGVFNIKRRRFE-LLSEP--QSGDLTSVA 218

  Fly   186 ISPTGDKLVLCTSGGYIMIIH 206
            :...|.|:...:|.|.|.:.:
Mouse   219 LMKYGKKVACGSSEGTIYLFN 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1523NP_651635.2 WD40 43..235 CDD:295369 34/151 (23%)
WD40 <45..>218 CDD:225201 34/151 (23%)
WD40 repeat 51..87 CDD:293791 6/30 (20%)
WD40 repeat 95..129 CDD:293791 11/33 (33%)
WD40 repeat 136..174 CDD:293791 8/37 (22%)
WD40 repeat 181..210 CDD:293791 6/26 (23%)
Wdr55NP_080740.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33
WD 1 37..76
WD40 <43..338 CDD:225201 34/151 (23%)
WD40 repeat 43..82 CDD:293791
WD 2 83..122 6/28 (21%)
WD40 84..331 CDD:295369 34/151 (23%)
WD40 repeat 89..126 CDD:293791 6/32 (19%)
WD 3 126..164 13/38 (34%)
WD40 repeat 131..166 CDD:293791 11/35 (31%)
WD 4 167..206 7/39 (18%)
WD40 repeat 173..207 CDD:293791 7/34 (21%)
WD 5 209..248 6/33 (18%)
WD40 repeat 214..251 CDD:293791 6/26 (23%)
WD 6 251..290
WD40 repeat 259..296 CDD:293791
WD 7 293..333
WD40 repeat 303..323 CDD:293791
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 364..388
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.