| Sequence 1: | NP_651635.2 | Gene: | CG1523 / 43400 | FlyBaseID: | FBgn0039601 | Length: | 621 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_002660.1 | Gene: | PLRG1 / 5356 | HGNCID: | 9089 | Length: | 514 | Species: | Homo sapiens |
| Alignment Length: | 260 | Identity: | 66/260 - (25%) |
|---|---|---|---|
| Similarity: | 101/260 - (38%) | Gaps: | 41/260 - (15%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 44 DAGRT----------GAIFNLEFNADGNVVVAA--TERKCVLVFDAITQK--------EIFKVPD 88
Fly 89 AHTDSVNCIKFF-DERLFATGSDDFTVALWDLRNMKQKLRVLHGHSNWVKNIEYSSKDKLLVSSG 152
Fly 153 FDGSIFTWDINSQTEQGLISQRVFHASGLMRCRISPTGDKLVLCTSGGYIMIIHHLDLTTLHKDL 217
Fly 218 CGFRPGIYRL-MQLGEQYIPQAAKYDHVFSKR-----QKKNRVELVTDFPENNDAEMIMALQIHP 276
Fly 277 276 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG1523 | NP_651635.2 | WD40 | 43..235 | CDD:295369 | 54/212 (25%) |
| WD40 | <45..>218 | CDD:225201 | 49/193 (25%) | ||
| WD40 repeat | 51..87 | CDD:293791 | 5/45 (11%) | ||
| WD40 repeat | 95..129 | CDD:293791 | 14/34 (41%) | ||
| WD40 repeat | 136..174 | CDD:293791 | 9/37 (24%) | ||
| WD40 repeat | 181..210 | CDD:293791 | 7/28 (25%) | ||
| PLRG1 | NP_002660.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 135..160 | 6/22 (27%) | |
| WD40 | 196..490 | CDD:238121 | 55/201 (27%) | ||
| WD 1 | 202..241 | 15/38 (39%) | |||
| WD40 repeat | 209..244 | CDD:293791 | 15/35 (43%) | ||
| WD 2 | 244..283 | 11/41 (27%) | |||
| WD40 repeat | 250..286 | CDD:293791 | 8/38 (21%) | ||
| WD 3 | 286..325 | 10/39 (26%) | |||
| WD40 repeat | 291..327 | CDD:293791 | 8/36 (22%) | ||
| WD 4 | 328..367 | 9/41 (22%) | |||
| WD40 repeat | 334..369 | CDD:293791 | 10/43 (23%) | ||
| WD 5 | 370..410 | 4/13 (31%) | |||
| WD40 repeat | 375..410 | CDD:293791 | 3/8 (38%) | ||
| WD 6 | 411..449 | ||||
| WD40 repeat | 416..455 | CDD:293791 | |||
| WD 7 | 460..499 | ||||
| WD40 repeat | 465..489 | CDD:293791 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||