DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1523 and poc1b

DIOPT Version :9

Sequence 1:NP_651635.2 Gene:CG1523 / 43400 FlyBaseID:FBgn0039601 Length:621 Species:Drosophila melanogaster
Sequence 2:XP_012814294.1 Gene:poc1b / 448445 XenbaseID:XB-GENE-944930 Length:470 Species:Xenopus tropicalis


Alignment Length:176 Identity:48/176 - (27%)
Similarity:92/176 - (52%) Gaps:19/176 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 TGAIFNLEFNADGNVVVAATERKCVLVFDAITQKEIFKVPDAHTDSVNCIKFF-DERLFATGSDD 111
            |..:..:.|::||:..:.|::.|.:..::...|:.::.:.: ||:.|.|.:|. |.||.|:.|||
 Frog   102 TAVVRCVNFSSDGHTFITASDDKSIKAWNLHRQRFLYSLTE-HTNWVRCARFSPDGRLIASCSDD 165

  Fly   112 FTVALWDLRNMKQKLRV-----LHGHSNWVKNIEYSSKDKLLVSSGFDGSIFTWDINSQTEQGLI 171
            .||.:||:.|   :|.:     ..||||:|   :::.....:.|:|.|.::..|||.:..   |:
 Frog   166 KTVRIWDITN---RLCINTFVDYKGHSNYV---DFNPMGTCVASAGVDSTVKVWDIRTNK---LL 221

  Fly   172 SQRVFHASGLMRCRISPTGDKLVLCTSGGYIMIIHHLD---LTTLH 214
            .....|.:|:......|:|:.|:..::.|.:.|:..|:   :.|||
 Frog   222 QHYQVHNAGVNSLSFHPSGNYLLTASNDGTVKILDLLEGRLIYTLH 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1523NP_651635.2 WD40 43..235 CDD:295369 48/176 (27%)
WD40 <45..>218 CDD:225201 48/176 (27%)
WD40 repeat 51..87 CDD:293791 6/35 (17%)
WD40 repeat 95..129 CDD:293791 15/39 (38%)
WD40 repeat 136..174 CDD:293791 8/37 (22%)
WD40 repeat 181..210 CDD:293791 6/31 (19%)
poc1bXP_012814294.1 WD40 12..298 CDD:238121 48/176 (27%)
WD40 repeat 21..58 CDD:293791
WD40 repeat 64..100 CDD:293791
WD40 repeat 105..141 CDD:293791 6/35 (17%)
WD40 repeat 148..183 CDD:293791 15/37 (41%)
WD40 repeat 190..225 CDD:293791 9/40 (23%)
WD40 repeat 231..267 CDD:293791 7/35 (20%)
WD40 repeat 273..297 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.