DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1523 and rig

DIOPT Version :9

Sequence 1:NP_651635.2 Gene:CG1523 / 43400 FlyBaseID:FBgn0039601 Length:621 Species:Drosophila melanogaster
Sequence 2:NP_611499.3 Gene:rig / 37335 FlyBaseID:FBgn0250850 Length:1235 Species:Drosophila melanogaster


Alignment Length:420 Identity:85/420 - (20%)
Similarity:148/420 - (35%) Gaps:116/420 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 TDSVNCIKFFDERLFATGSDDFTVALWDLRNMKQKLRVLHGHSNWVKNIEYSS---------KDK 146
            ||...|.  .|...||...:|.:|.:.:.:..::..:.||   .:..|.|.:|         :..
  Fly   745 TDIAWCP--LDSNKFAVSGNDRSVYVMEFQPTERNWKTLH---TFTANTEKASITSMRWSHTQKH 804

  Fly   147 LLVSSGFDGSIFTWDINSQTEQGLISQRVFHASGLMRC-RISPTGDKLVLCTSGGYIMIIHHLDL 210
            ||::...:|.:..|:.|:..:..|..  .:|..  |.| ...||.:.:::|:  |..:.:..:|:
  Fly   805 LLLTFHIEGKVCLWNCNAPEKPPLTI--TYHCP--MWCGMFLPTNENIIMCS--GKALSVELIDI 863

  Fly   211 TTL----HKDLCGFRPGIYRLM-------QLGEQYIP----------------QAAKYD-HVFSK 247
            ...    .|.:|   |.:..|:       .|.:.|.|                .|||.: .|.:|
  Fly   864 KDALEGDEKSIC---PKVDALLNVKWASKSLTQPYAPVLTAAEKKRQRRDQRKAAAKLEVDVANK 925

  Fly   248 RQKK--NRVELVTDFPENNDA-------EMIMALQIHPHCCCMLTRNVS------CDEQS----- 292
            .|||  ..|..|.|.|.|:..       ||:.||.:...     ..|.|      |.|||     
  Fly   926 DQKKIQESVTAVIDNPTNDKCTQETPVEEMLEALSLDKE-----QNNRSAKECPKCKEQSPDSFT 985

  Fly   293 -EWTCIHDINEEPVRSEDEQ------DEVEPQPKRKRVSTTLASR-----------SSLNESQDQ 339
             ..||::...:|..:|..|:      ::.....|...:|...:|:           ::|..|..:
  Fly   986 HSRTCLYLTQKELNKSALEKLAIVLTEDSAKIDKSVLISKLFSSKVMAKELIATELTNLKHSNTK 1050

  Fly   340 DTVGLTPRQARRPLRVSSVQVFQLDNSGAGRGASDNPSVLTRSDSFIPDIW-----AAEVTVQER 399
            |...|....:...||.      :|:...|.:..::....|..|.||  .:|     |....::|:
  Fly  1051 DIAPLCLAMSTFKLRE------ELEQHIANKTLTERHVSLAPSVSF--TLWQDCCRAYAKQMEEK 1107

  Fly   400 AIRQNRARVSNNHVSGYNFVYAISSGVLPL 429
            ....        |.:.|.|...:.|..:.|
  Fly  1108 GYIM--------HAATYLFSQGMQSEAIKL 1129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1523NP_651635.2 WD40 43..235 CDD:295369 32/164 (20%)
WD40 <45..>218 CDD:225201 28/140 (20%)
WD40 repeat 51..87 CDD:293791
WD40 repeat 95..129 CDD:293791 6/33 (18%)
WD40 repeat 136..174 CDD:293791 9/46 (20%)
WD40 repeat 181..210 CDD:293791 6/29 (21%)
rigNP_611499.3 WD40 <80..>215 CDD:295369
WD40 80..>215 CDD:225201
WD40 repeat 116..160 CDD:293791
WD40 repeat 167..204 CDD:293791
WD40 434..821 CDD:225201 17/80 (21%)
WD40 446..719 CDD:295369
WD40 613..874 CDD:295369 28/139 (20%)
WD40 repeat 617..654 CDD:293791
WD40 repeat 659..691 CDD:293791
WD40 repeat 693..732 CDD:293791
WD40 repeat 744..785 CDD:293791 10/44 (23%)
WD40 repeat 793..831 CDD:293791 6/39 (15%)
WD40 repeat 838..861 CDD:293791 5/24 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4155
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.