DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1523 and CG30116

DIOPT Version :9

Sequence 1:NP_651635.2 Gene:CG1523 / 43400 FlyBaseID:FBgn0039601 Length:621 Species:Drosophila melanogaster
Sequence 2:NP_725799.1 Gene:CG30116 / 37126 FlyBaseID:FBgn0028496 Length:1922 Species:Drosophila melanogaster


Alignment Length:491 Identity:100/491 - (20%)
Similarity:170/491 - (34%) Gaps:139/491 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 FHIHRSDDNSLMRRIYSSMNMFNSYHANCWPTDAGRTGAIFNLEFNADGNVVVAATERKCVLVFD 76
            |.:..:.||:|  :|:|.......|       ....:..|...|.:||...:::.:....:.|:.
  Fly  1349 FAVSTNGDNTL--KIWSLTQEDEKY-------SVSHSDEITCFEISADSVHIISGSRDMSLKVWQ 1404

  Fly    77 AITQKEIFKVPDAHTDSVNC--IKFFDERLFATGSDDFTVALWDLRNMKQKLRVLHGHSNWVKNI 139
            | |..::.:|...|:|:|.|  :...::....:||.|..:.||||.. .:::..|.||...|..:
  Fly  1405 A-TGGKLSQVLVGHSDAVTCVAVSVTNKTQVLSGSKDMNLILWDLLT-GEEVHTLAGHLGPVIGV 1467

  Fly   140 EYSSKDKLLVSSGFDGSIFTWDINSQTEQGLISQRVFHASGLMRCRISPTGDKLVLCTSGGYIMI 204
            :.|:.....||...|.::..|    :|::||       |...::..:..|...:.|..|...:.:
  Fly  1468 KVSADGSTAVSGSDDKTLIVW----ETKRGL-------ALTSLQMHVPFTHFDISLEVSRVLVQL 1521

  Fly   205 I--HHLDLTTLH----------------KDLCGFRP-GIYRLMQLGEQYIPQAAKYDHVFSKRQK 250
            :  ::|.:..||                ||:...|| |..|.|                  ||..
  Fly  1522 VDSYNLPVICLHNTPAQYVKLPTYSGPSKDVEDLRPQGPKRQM------------------KRLL 1568

  Fly   251 KNRVELVTDFPENNDAEM---IMALQIHPHCCCMLTRNVSCDEQSE----WTCIHDINEEPVRSE 308
            |..|.|.|...:.....:   :|..|:........:.:.|.:|.|:    .|.....|..|.::.
  Fly  1569 KKEVSLDTYTWQKKYGHLTSSVMMAQVDERLKRRFSVSASMEEISKIAETKTGASQANLGPEQAA 1633

  Fly   309 DEQ----DEVEP-----QPKRKRVSTTLASRSSLNESQDQDTVGLTPRQARRPLRVSSVQVFQLD 364
            ..|    |::|.     .|.|:|.:..|:.::||.|.:               |..|....:|.:
  Fly  1634 LAQSQHFDQLEALWNKRSPPRRRHNAGLSRQTSLVEDR---------------LESSDDDEYQDE 1683

  Fly   365 NSGAGRGASDNPSVLTRSDSF--IPDIWAAEVTVQERAIRQNRARVSNNHVSGYNFVYAISSGVL 427
            .:|....:.||...|.|....  :.|.|.                                    
  Fly  1684 RAGMLSASYDNIHHLARLPGLRSLHDAWK------------------------------------ 1712

  Fly   428 PLRQLGANSLMGSSTSPRP---LTTPPPTESNQSSS 460
                  .|||...|.|.|.   ::||||..|..|||
  Fly  1713 ------TNSLRVPSRSARTKFYVSTPPPQNSQNSSS 1742

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1523NP_651635.2 WD40 43..235 CDD:295369 45/212 (21%)
WD40 <45..>218 CDD:225201 40/192 (21%)
WD40 repeat 51..87 CDD:293791 7/35 (20%)
WD40 repeat 95..129 CDD:293791 8/35 (23%)
WD40 repeat 136..174 CDD:293791 9/37 (24%)
WD40 repeat 181..210 CDD:293791 4/30 (13%)
CG30116NP_725799.1 AAA_16 359..505 CDD:289934
WD40 repeat 901..937 CDD:293791
WD40 933..1282 CDD:238121
WD40 repeat 942..982 CDD:293791
WD40 repeat 988..1024 CDD:293791
WD40 1022..1484 CDD:225201 34/145 (23%)
WD40 repeat 1029..1064 CDD:293791
WD40 repeat 1071..1106 CDD:293791
WD40 repeat 1112..1147 CDD:293791
WD40 repeat 1216..1252 CDD:293791
WD40 1248..1502 CDD:238121 39/174 (22%)
WD40 repeat 1258..1294 CDD:293791
WD40 repeat 1299..1335 CDD:293791
WD40 repeat 1340..1374 CDD:293791 7/33 (21%)
WD40 repeat 1379..1415 CDD:293791 8/36 (22%)
WD40 repeat 1421..1458 CDD:293791 9/37 (24%)
WD40 repeat 1464..1488 CDD:293791 5/23 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4155
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.