DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1523 and AgaP_AGAP007626

DIOPT Version :9

Sequence 1:NP_651635.2 Gene:CG1523 / 43400 FlyBaseID:FBgn0039601 Length:621 Species:Drosophila melanogaster
Sequence 2:XP_564611.3 Gene:AgaP_AGAP007626 / 3290403 VectorBaseID:AGAP007626 Length:336 Species:Anopheles gambiae


Alignment Length:143 Identity:33/143 - (23%)
Similarity:66/143 - (46%) Gaps:6/143 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 NLEFNADGNVVVAATERKCVLVFDAITQKEIFKVPDAHTDSVNCIKFF-DERLFATGSDDFTVAL 116
            ::.::.||..:.:......:.:||....| :.:..:.|..||..:.|. |.::..|.|||..:.|
Mosquito   181 SIAYSPDGKYIASGAIDGIINIFDVAAGK-VAQTLEGHAMSVRSLCFSPDSQMLLTASDDGHMKL 244

  Fly   117 WDLRNMKQKLRVLHGHSNWVKNIEYSSKDKLLVSSGFDGSIFTWDINSQTEQGLISQRVFHASGL 181
            :|:.: ...:..|.||::||.::.:|...|...||..|.::..|::   .|:..:.....||..:
Mosquito   245 YDVAH-SDVVGTLSGHASWVLSVSFSGDGKNFASSSSDKTVKIWNV---AERQCLHTFTEHADQV 305

  Fly   182 MRCRISPTGDKLV 194
            ...|.||....::
Mosquito   306 WGVRYSPDSANVI 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1523NP_651635.2 WD40 43..235 CDD:295369 33/143 (23%)
WD40 <45..>218 CDD:225201 33/143 (23%)
WD40 repeat 51..87 CDD:293791 5/33 (15%)
WD40 repeat 95..129 CDD:293791 8/34 (24%)
WD40 repeat 136..174 CDD:293791 8/37 (22%)
WD40 repeat 181..210 CDD:293791 3/14 (21%)
AgaP_AGAP007626XP_564611.3 WD40 58..>332 CDD:225201 33/143 (23%)
WD40 58..330 CDD:238121 33/143 (23%)
WD40 repeat 95..133 CDD:293791
WD40 repeat 136..172 CDD:293791
WD40 repeat 180..215 CDD:293791 5/34 (15%)
WD40 repeat 221..257 CDD:293791 9/36 (25%)
WD40 repeat 263..299 CDD:293791 8/38 (21%)
WD40 repeat 305..329 CDD:293791 3/14 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4155
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.