DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1523 and CG3071

DIOPT Version :9

Sequence 1:NP_651635.2 Gene:CG1523 / 43400 FlyBaseID:FBgn0039601 Length:621 Species:Drosophila melanogaster
Sequence 2:NP_569993.1 Gene:CG3071 / 31213 FlyBaseID:FBgn0023527 Length:535 Species:Drosophila melanogaster


Alignment Length:179 Identity:44/179 - (24%)
Similarity:77/179 - (43%) Gaps:23/179 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 FNLEFNADGNVVVAATERKCVLVFDAITQKEIFKVPDAHTDSVNCIKFFDERL-FATGSDDFTVA 115
            :...|..||.::.|..|...|.:||. |.:.|.::...||..|:...|..::| .|:..||.:|.
  Fly    85 YGATFRQDGRLLAAGDEEGHVKLFDT-TSRNILRLFKGHTAPVHRTFFTADKLQLASFGDDKSVR 148

  Fly   116 LWDLRNMKQKLRVLHGHSNWVK-NIEYSSKDKLLVSSGFDGSIFTWDINSQTEQGLISQRVFHAS 179
            |||:.|.|........|:::|: ...:.....:.||.|:||.|..:|..::|   .:.:.:.|.:
  Fly   149 LWDVANEKVVQTYEDTHTDYVRAGAMHPQAGHMFVSGGYDGKIKLYDTRAET---AVQRTLDHGA 210

  Fly   180 GLMRCRISPTGDKLVLCTSGG---------------YIMIIHHLDLTTL 213
            .:......|.|.  :..::||               .:|..||..:|.|
  Fly   211 PVESMLFLPNGS--IFVSAGGSQVRVWDLISGCRLLTMMSQHHKTVTCL 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1523NP_651635.2 WD40 43..235 CDD:295369 44/179 (25%)
WD40 <45..>218 CDD:225201 44/179 (25%)
WD40 repeat 51..87 CDD:293791 10/34 (29%)
WD40 repeat 95..129 CDD:293791 11/34 (32%)
WD40 repeat 136..174 CDD:293791 9/38 (24%)
WD40 repeat 181..210 CDD:293791 7/43 (16%)
CG3071NP_569993.1 WD40 <26..283 CDD:225201 44/179 (25%)
WD40 repeat 87..121 CDD:293791 10/34 (29%)
WD40 89..318 CDD:238121 44/175 (25%)
WD40 repeat 126..162 CDD:293791 12/35 (34%)
WD40 repeat 170..206 CDD:293791 8/38 (21%)
WD40 repeat 212..247 CDD:293791 4/36 (11%)
WD40 repeat 254..288 CDD:293791 2/4 (50%)
WD40 repeat 295..318 CDD:293791
UTP15_C 352..494 CDD:286472
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.