DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1523 and Wdr55

DIOPT Version :9

Sequence 1:NP_651635.2 Gene:CG1523 / 43400 FlyBaseID:FBgn0039601 Length:621 Species:Drosophila melanogaster
Sequence 2:NP_001017932.1 Gene:Wdr55 / 307494 RGDID:1305640 Length:384 Species:Rattus norvegicus


Alignment Length:151 Identity:35/151 - (23%)
Similarity:70/151 - (46%) Gaps:4/151 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 FNADGNVVVAATERKCVLVFDAITQKEIFKVPDAHTDSVNCIKFFDERLFATGSDDFTVALWDLR 120
            |:.||..:|..::.|.:.|.|....:...::..||:..:|.:...||.:..||.|...:.|||.|
  Rat    92 FSEDGQKLVTVSKDKAIHVLDVEQGQLERRISKAHSAPINSLLLVDENVLVTGDDTGGIRLWDQR 156

  Fly   121 NMKQKLRVLHGHSNWVKNIEYSSKDKLLVSSGFDGSIFTWDINSQTEQGLISQRVFHASGLMRCR 185
            . :..|..:..|..::.::......|||:::..||.:..::|..:..: |:|:.  .:..|....
  Rat   157 K-EGPLMDMRQHEEYIADMALDPAKKLLLTASGDGCLGVFNIKRRRFE-LLSEP--QSGDLTSVA 217

  Fly   186 ISPTGDKLVLCTSGGYIMIIH 206
            :...|.|:...:|.|.|.:.:
  Rat   218 LMKYGKKVACGSSEGTIYLFN 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1523NP_651635.2 WD40 43..235 CDD:295369 35/151 (23%)
WD40 <45..>218 CDD:225201 35/151 (23%)
WD40 repeat 51..87 CDD:293791 7/30 (23%)
WD40 repeat 95..129 CDD:293791 11/33 (33%)
WD40 repeat 136..174 CDD:293791 8/37 (22%)
WD40 repeat 181..210 CDD:293791 6/26 (23%)
Wdr55NP_001017932.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33
WD 1 36..75
WD40 <42..337 CDD:225201 35/151 (23%)
WD40 repeat 42..81 CDD:293791
WD 2 82..121 7/28 (25%)
WD40 83..330 CDD:295369 35/151 (23%)
WD40 repeat 88..125 CDD:293791 7/32 (22%)
WD 3 125..163 13/38 (34%)
WD40 repeat 130..165 CDD:293791 11/35 (31%)
WD 4 166..205 7/39 (18%)
WD40 repeat 172..206 CDD:293791 7/34 (21%)
WD 5 208..247 6/33 (18%)
WD40 repeat 213..250 CDD:293791 6/26 (23%)
WD 6 250..289
WD40 repeat 258..295 CDD:293791
WD 7 293..332
WD40 repeat 302..322 CDD:293791
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 362..384
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.