DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1523 and Wsb2

DIOPT Version :9

Sequence 1:NP_651635.2 Gene:CG1523 / 43400 FlyBaseID:FBgn0039601 Length:621 Species:Drosophila melanogaster
Sequence 2:XP_008767442.1 Gene:Wsb2 / 288692 RGDID:1359599 Length:406 Species:Rattus norvegicus


Alignment Length:171 Identity:43/171 - (25%)
Similarity:73/171 - (42%) Gaps:33/171 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 HTDSVNCIKFF--DERLFATGSDDFTVALWDLRNMKQKLRVLHGHSNWVKNIEYSSKDKLLVSSG 152
            |.|.|..:.|.  ...:..:.|.|.|:.:|||....::::||.||..||.....|....:|.|:.
  Rat   154 HQDVVRDLSFTPNGSLILVSASRDKTLRIWDLNKHGKQIQVLSGHLQWVYCCSISPDCSMLCSAA 218

  Fly   153 FDGSIFTWDINSQTEQGLISQRVFHASGLMRCRISPTGDKLVLCT-----------SGGYIMIIH 206
            .:.|:|.|.:.|.|   ||.:...|.|.::.|..||....||..:           :|..:..:|
  Rat   219 GEKSVFLWSMRSYT---LIRKLEGHQSSVVSCDFSPDSALLVTASYDTSVIMWDPYTGERLRSLH 280

  Fly   207 H------LDLTTLH----KDLCGFRPGIY-------RLMQL 230
            |      :|.:.:|    :.:|....|:|       ||:::
  Rat   281 HTQLEAPVDDSDVHMSSLRSVCFSPEGLYLATVADDRLLRI 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1523NP_651635.2 WD40 43..235 CDD:295369 43/171 (25%)
WD40 <45..>218 CDD:225201 38/150 (25%)
WD40 repeat 51..87 CDD:293791
WD40 repeat 95..129 CDD:293791 7/35 (20%)
WD40 repeat 136..174 CDD:293791 11/37 (30%)
WD40 repeat 181..210 CDD:293791 8/45 (18%)
Wsb2XP_008767442.1 WD40 repeat 31..91 CDD:293791
WD40 32..369 CDD:225201 43/171 (25%)
WD40 123..362 CDD:238121 43/171 (25%)
WD40 repeat 159..197 CDD:293791 9/37 (24%)
WD40 repeat 202..238 CDD:293791 11/38 (29%)
WD40 repeat 246..291 CDD:293791 9/44 (20%)
WD40 repeat 298..330 CDD:293791 5/24 (21%)
WD40 repeat 338..374 CDD:293791
SOCS_WSB_SWIP 366..404 CDD:239702
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.