| Sequence 1: | NP_651635.2 | Gene: | CG1523 / 43400 | FlyBaseID: | FBgn0039601 | Length: | 621 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_796316.2 | Gene: | Taf5 / 226182 | MGIID: | 2442144 | Length: | 801 | Species: | Mus musculus |
| Alignment Length: | 215 | Identity: | 47/215 - (21%) |
|---|---|---|---|
| Similarity: | 81/215 - (37%) | Gaps: | 51/215 - (23%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 46 GRTGAIFNLEFNADGNVVVAATER-----------KCVL--------VFD--------------- 76
Fly 77 -------AITQKEIFKVPDAHTDSVNCIKFF-DERLFATGSDDFTVALWDLRNMKQKLRVLHGHS 133
Fly 134 NWVKNIEYSSKDKLLVSSGFDGSIFTWDINSQTEQGL-ISQRVFHASGLMRCRISPTGDKLVLCT 197
Fly 198 SGGYIMIIHHLDLTTLHKDL 217 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG1523 | NP_651635.2 | WD40 | 43..235 | CDD:295369 | 47/215 (22%) |
| WD40 | <45..>218 | CDD:225201 | 47/215 (22%) | ||
| WD40 repeat | 51..87 | CDD:293791 | 8/76 (11%) | ||
| WD40 repeat | 95..129 | CDD:293791 | 15/34 (44%) | ||
| WD40 repeat | 136..174 | CDD:293791 | 9/38 (24%) | ||
| WD40 repeat | 181..210 | CDD:293791 | 5/28 (18%) | ||
| Taf5 | NP_796316.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..69 | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 156..176 | ||||
| TAF5_NTD2 | 212..344 | CDD:176269 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 385..438 | ||||
| WD40 | <460..741 | CDD:225201 | 44/206 (21%) | ||
| WD 1 | 469..508 | ||||
| WD40 | 473..743 | CDD:238121 | 45/208 (22%) | ||
| WD40 repeat | 474..542 | CDD:293791 | 47/215 (22%) | ||
| WD 2 | 542..581 | 7/38 (18%) | |||
| WD40 repeat | 548..584 | CDD:293791 | 5/35 (14%) | ||
| WD 3 | 584..625 | 3/40 (8%) | |||
| WD40 repeat | 589..625 | CDD:293791 | 3/35 (9%) | ||
| WD 4 | 626..667 | 17/41 (41%) | |||
| WD40 repeat | 632..667 | CDD:293791 | 15/35 (43%) | ||
| WD 5 | 668..707 | 11/42 (26%) | |||
| WD40 repeat | 673..709 | CDD:293791 | 9/39 (23%) | ||
| WD 6 | 710..749 | 9/42 (21%) | |||
| WD40 repeat | 715..757 | CDD:293791 | 8/37 (22%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||