DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1523 and Grwd1

DIOPT Version :9

Sequence 1:NP_651635.2 Gene:CG1523 / 43400 FlyBaseID:FBgn0039601 Length:621 Species:Drosophila melanogaster
Sequence 2:NP_700468.2 Gene:Grwd1 / 101612 MGIID:2141989 Length:446 Species:Mus musculus


Alignment Length:174 Identity:38/174 - (21%)
Similarity:69/174 - (39%) Gaps:43/174 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 SMNMFNSYHANCWPTD----AGRTGAIFNLEF-----------NADGNV----VVAATERKCVLV 74
            :::::.......|..|    .|.|.::.:|::           :||.::    :.||..:.|:|.
Mouse   238 NVHLWTPTEGGSWNVDQRPFVGHTRSVEDLQWSPTEDTVFASCSADASIRIWDIRAAPGKACMLT 302

  Fly    75 FDAITQKEIFKVPDAHTDSVNCIKFF-DERLFATGSDDFTVALWDLRNMK--QKLRVLHGHSNWV 136
                       ...||...||.|.:. .|....:|.||..:.:||||..|  ..:.....|...|
Mouse   303 -----------TATAHDGDVNVISWSRREPFLLSGGDDGALKVWDLRQFKSGSPVATFKQHMAPV 356

  Fly   137 KNIEYSSKDK-LLVSSGFDGSIFTWDI---------NSQTEQGL 170
            .::|:..:|. :..:||.|..|..||:         .::|:.||
Mouse   357 TSVEWHPQDSGVFAASGADNQITQWDLAVERDPESGETETDPGL 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1523NP_651635.2 WD40 43..235 CDD:295369 37/160 (23%)
WD40 <45..>218 CDD:225201 36/154 (23%)
WD40 repeat 51..87 CDD:293791 7/50 (14%)
WD40 repeat 95..129 CDD:293791 11/36 (31%)
WD40 repeat 136..174 CDD:293791 12/45 (27%)
WD40 repeat 181..210 CDD:293791
Grwd1NP_700468.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
CAF1C_H4-bd 44..111 CDD:289068
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 111..141
WD40 repeat 175..212 CDD:293791
WD40 <194..>383 CDD:225201 34/155 (22%)
WD40 206..>384 CDD:295369 35/156 (22%)
WD 1 212..252 1/13 (8%)
WD40 repeat 218..259 CDD:293791 2/20 (10%)
WD 2 259..299 7/39 (18%)
WD40 repeat 265..306 CDD:293791 7/51 (14%)
WD 3 306..345 14/38 (37%)
WD40 repeat 311..350 CDD:293791 12/38 (32%)
WD 4 351..391 10/39 (26%)
WD 5 412..445
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.