DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wdn and si:dkeyp-113d7.1

DIOPT Version :9

Sequence 1:NP_476900.1 Gene:wdn / 43398 FlyBaseID:FBgn0005642 Length:869 Species:Drosophila melanogaster
Sequence 2:NP_999959.1 Gene:si:dkeyp-113d7.1 / 407709 ZFINID:ZDB-GENE-030131-755 Length:498 Species:Danio rerio


Alignment Length:584 Identity:145/584 - (24%)
Similarity:226/584 - (38%) Gaps:153/584 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DAGTPTKAAHDEILSSLLRINNFDSISS-----------IKDE-SLD----IDLSACVTISSASL 76
            |.||||..    :|||........|::|           ||.| .||    :|||....:|:|.|
Zfish    31 DCGTPTLT----MLSSECSTPTLSSLASEIVEPMAMLPCIKSEPDLDPIRTVDLSVIQPLSTAEL 91

  Fly    77 VNGN---SLSSTDFWRV---LDESAQNNTEL-----NLSSDVCRDDLAATSSST--VPSTLTSDN 128
            .:..   .:|..|:.:.   .|..:.::|||     :....:..|.::..|.|.  :.|...||.
Zfish    92 GSDQIKMEISGLDYIKSEHHSDLHSFHSTELGSYKSHYEPSLVFDYISHVSDSLEYIKSEHHSDL 156

  Fly   129 HS--SSEFSVTFLRPEPPNAFTNSPFKKTSSSGTSTPVKLSPEQLHQQHQLQMPQSQLLQRKPKL 191
            ||  :||........||  .|..|.. ||..:|.        |.:|           :.:.:.:|
Zfish   157 HSYYASELGTIKTEYEP--IFMTSHI-KTEMNGL--------ESIH-----------MAELRTEL 199

  Fly   192 PAATAVRLKVFKEEPPEEKHPPEQVVTKVEVCESELLPPSFTIFQQAKSAESVADAASMPPPAAS 256
                             :|..||.::..:...:|:.  .|.::::......:.|.||..|     
Zfish   200 -----------------DKLRPETLIDGIGKLDSDF--SSNSLYELTSVHANKAQAAHHP----- 240

  Fly   257 ETKPLEVDPAPLHKCLDCNGLLLETPDEVAKHEAAAHRLRLTYRCSECQREFELLAGLKKHLKTH 321
             |......|.| .|..:..|   |.|                :.|::|.:.|..|..||.|.:.|
Zfish   241 -TSTKGHGPTP-RKPRNPTG---EKP----------------FSCTQCGKNFSTLGNLKTHKRIH 284

  Fly   322 RTEGRKDTWKKCPDCGKCL-KLGSMWMHRKIHSDNKKYQCDICGQKFVQKINLTHHARIHSSEKP 385
            ..| |..|   |..|||.. :.|::..|:.||:..|.|.|..|.:.|.:..:|..|.|:|:.|||
Zfish   285 TGE-RPYT---CSQCGKSFGQAGNLKRHQLIHTGQKPYTCAHCPKGFTKADDLRSHQRLHTGEKP 345

  Fly   386 YECPECQKRFQERSHLQRHQKYHAQTRSYRCEKCGKMYKTERCLKVHNLVHLEQRPFACTVCDKS 450
            :.|.||.|.|.:...|:.||..|...|.:.|..|||.:..|...:.|..:|:.::|::|:.|.||
Zfish   346 FSCAECGKSFSQTKELKAHQLSHTGERPFCCSLCGKSFSKETSYRNHQQIHMGEKPYSCSQCGKS 410

  Fly   451 FISNSKLKQHSNIHTGMRPFKCNYCPRDFTNFPNWLKHTRRRHKVDHKTGEHLENIPSYCSKKST 515
            |.::..||.|..||:|.|||.|..|.:.|..    |.|.:...::  .|||.    |..|.:.. 
Zfish   411 FSNSGVLKTHEKIHSGERPFGCTQCGKHFGR----LGHLKAHQQI--HTGER----PYTCQQCG- 464

  Fly   516 TNKAQKAAAAAAAAAAASSAVNPNELSASSELKAKANLTSTAAPAPAKQARKKKQPQQATLAAL 579
                                   ...|.|..|||.            :|..|:::|..::.::|
Zfish   465 -----------------------KNFSQSGHLKAH------------EQIHKRERPDLSSGSSL 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wdnNP_476900.1 C2H2 Zn finger 301..321 CDD:275368 7/19 (37%)
RPB9 333..425 CDD:224510 34/92 (37%)
C2H2 Zn finger 333..352 CDD:275368 6/19 (32%)
zf-H2C2_2 344..369 CDD:290200 8/24 (33%)
zf-C2H2 358..380 CDD:278523 7/21 (33%)
C2H2 Zn finger 360..380 CDD:275368 6/19 (32%)
zf-H2C2_2 372..395 CDD:290200 11/22 (50%)
zf-C2H2 386..408 CDD:278523 8/21 (38%)
C2H2 Zn finger 388..436 CDD:275368 16/47 (34%)
zf-H2C2_2 400..425 CDD:290200 9/24 (38%)
C2H2 Zn finger 416..433 CDD:275368 5/16 (31%)
zf-H2C2_2 429..453 CDD:290200 8/23 (35%)
C2H2 Zn finger 444..464 CDD:275368 8/19 (42%)
zf-H2C2_2 457..481 CDD:290200 12/23 (52%)
C2H2 Zn finger 472..493 CDD:275368 5/20 (25%)
si:dkeyp-113d7.1NP_999959.1 COG5048 <260..414 CDD:227381 55/173 (32%)
C2H2 Zn finger 264..284 CDD:275368 7/19 (37%)
zf-H2C2_2 276..299 CDD:290200 11/26 (42%)
C2H2 Zn finger 292..312 CDD:275368 6/19 (32%)
zf-H2C2_2 304..328 CDD:290200 7/23 (30%)
C2H2 Zn finger 320..340 CDD:275368 6/19 (32%)
zf-H2C2_2 332..357 CDD:290200 12/24 (50%)
C2H2 Zn finger 348..368 CDD:275368 8/19 (42%)
zf-H2C2_2 360..384 CDD:290200 9/23 (39%)
C2H2 Zn finger 376..396 CDD:275368 6/19 (32%)
zf-H2C2_2 388..413 CDD:290200 8/24 (33%)
C2H2 Zn finger 404..424 CDD:275368 8/19 (42%)
C2H2 Zn finger 432..452 CDD:275368 5/25 (20%)
zf-H2C2_2 444..469 CDD:290200 6/54 (11%)
C2H2 Zn finger 460..480 CDD:275368 7/55 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.