DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wdn and CG14655

DIOPT Version :10

Sequence 1:NP_476900.1 Gene:wdn / 43398 FlyBaseID:FBgn0005642 Length:869 Species:Drosophila melanogaster
Sequence 2:NP_649494.1 Gene:CG14655 / 40594 FlyBaseID:FBgn0037275 Length:525 Species:Drosophila melanogaster


Alignment Length:525 Identity:109/525 - (20%)
Similarity:176/525 - (33%) Gaps:142/525 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 FKKTS---SSGTSTPVKLSPEQLHQQHQLQMPQSQLLQRKPKLPAATAVRLKVFKEEPPEEKHPP 213
            |..||   ..|..:|....|..         .:..|....||..|.......|....||....||
  Fly    56 FSHTSLMAQEGNESPANGQPAS---------SRGFLAAAPPKRRAKRTRSKPVVPTPPPVRTTPP 111

  Fly   214 EQVVTKVEVCE-----SELLPPSFTIFQQAKSAESVADAASMPPPAASETKPLEVDPAPLHKCLD 273
                ...::||     :||......:..:....|          |...|.:..|.|..|      
  Fly   112 ----AHCDICEFSFRNTELRDMHVRLVHENAEGE----------PKQKEPQQKEPDQEP------ 156

  Fly   274 CNGLLLETPDEVAKHEAAAHRLRLTYRCSECQREFELLAGLKKHLKT------------------ 320
                                     |:|..|.:.|.:...|:.|||.                  
  Fly   157 -------------------------YKCHLCSKTFRMKGSLRIHLKVVHMMGVPCSNPNPNPNPS 196

  Fly   321 ----------------------HRTE------GRKDTWKKCPDCGKCLKLGSMWMHRKIHSD--- 354
                                  ..||      |...|   |.........|::.|.::..|.   
  Fly   197 PTPASTTSAVTATPKLSICDRIRHTEPGALGNGNNST---CTASQPYALSGALSMLQQSPSSPES 258

  Fly   355 ----NKKYQCDICGQKFVQKINLTHHARIHSSEKPYECPECQKRFQERSHLQRHQKYHAQTRSYR 415
                .|.::||:|.:.|..|..|..|.|:|:.|.||.|..|.:.|..:....:|..||::.:.:.
  Fly   259 GTATPKLWECDVCSKSFTTKYFLKKHKRLHTGEMPYTCEICARTFTFQQSYHKHLLYHSEVKPHV 323

  Fly   416 CEKCGKMYKTERCLKVHNLVHLEQRPFACTVCDKSFISNSKLKQHSNIHTGMRPFKCNYCPRDFT 480
            |..||:.:|....|..|..:|..::||.|.||.|.|........|:.||||:.|:||..|.:.|.
  Fly   324 CGVCGRAFKELSTLHNHQRIHSGEKPFKCEVCGKCFRQRVSFLVHTRIHTGVMPYKCELCQKTFR 388

  Fly   481 NFPNWLKHTRRRHKVDHKTGEHLENIPSYCSKKSTTNKAQKAAAAAAAAAAASSAVNPNELSASS 545
                 .|.::|.|:...:..:..|.:.....:.:.::.....|:|..||..:||.|:|.:     
  Fly   389 -----YKVSQRTHRCPTEEAQTPEQLIKAFLEGNDSHTQPSPASAEIAAINSSSIVDPEQ----- 443

  Fly   546 ELKAKANLTSTAAPAPAKQARK--------KKQPQQATLAALGIT--LPAGTALQQVHPVPLAQQ 600
                :|.|:.:......:|.:|        :::.|..:|..:.:.  ...|:.|||:..:.:...
  Fly   444 ----EALLSQSIDDIVVEQCQKLGICGVEPREEGQLISLQPVAVVHFSGNGSPLQQLQNLRIYSP 504

  Fly   601 HQQEL 605
            .|.||
  Fly   505 QQTEL 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wdnNP_476900.1 zf-C2HE <279..321 CDD:465082 8/81 (10%)
C2H2 Zn finger 301..321 CDD:275368 7/59 (12%)
C2H2 Zn finger 333..352 CDD:275368 3/18 (17%)
zf-C2H2 358..380 CDD:395048 8/21 (38%)
C2H2 Zn finger 360..380 CDD:275368 8/19 (42%)
zf-H2C2_2 376..395 CDD:463886 8/18 (44%)
zf-C2H2 386..408 CDD:395048 5/21 (24%)
C2H2 Zn finger 388..436 CDD:275368 12/47 (26%)
zf-H2C2_2 400..425 CDD:463886 6/24 (25%)
C2H2 Zn finger 416..433 CDD:275368 5/16 (31%)
SUF4-like 440..>507 CDD:411020 21/66 (32%)
C2H2 Zn finger 444..465 CDD:411020 7/20 (35%)
C2H2 Zn finger 444..464 CDD:275368 6/19 (32%)
zf-H2C2_2 457..481 CDD:463886 10/23 (43%)
C2H2 Zn finger 472..493 CDD:411020 5/20 (25%)
C2H2 Zn finger 472..493 CDD:275368 5/20 (25%)
CG14655NP_649494.1 SUF4-like <157..>180 CDD:411020 8/22 (36%)
C2H2 Zn finger 159..180 CDD:411020 7/20 (35%)
SFP1 <264..345 CDD:227516 25/80 (31%)
C2H2 Zn finger 268..288 CDD:275368 8/19 (42%)
C2H2 Zn finger 324..344 CDD:275368 6/19 (32%)
zf-H2C2_2 340..361 CDD:463886 9/20 (45%)
C2H2 Zn finger 352..372 CDD:275368 6/19 (32%)
zf-H2C2_2 368..389 CDD:463886 10/25 (40%)
C2H2 Zn finger 380..396 CDD:275368 5/20 (25%)

Return to query results.
Submit another query.