DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wdn and scrt

DIOPT Version :9

Sequence 1:NP_476900.1 Gene:wdn / 43398 FlyBaseID:FBgn0005642 Length:869 Species:Drosophila melanogaster
Sequence 2:NP_001261390.1 Gene:scrt / 38469 FlyBaseID:FBgn0004880 Length:653 Species:Drosophila melanogaster


Alignment Length:602 Identity:125/602 - (20%)
Similarity:199/602 - (33%) Gaps:223/602 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 DESLDI----------------DLSACVTISSASLVNGNSLSSTDFWRVLDESAQNNTELNLSSD 106
            ||.:|:                |.:|....||.:..:.:|.||.     ::.||...|      .
  Fly    55 DEEIDVVGDKFLIKLEKQRTTADAAAAAATSSEAATSHSSNSSN-----MEASATTTT------S 108

  Fly   107 VCRDDLAATSSSTVPS---------TLTSDN------------HSSS-----EFSVTFLR----- 140
            .|....:.|:.:|.||         |..:.|            |.::     |..:|.:|     
  Fly   109 KCWGPSSPTAGTTAPSPPPHSPEAATRVAGNVYNGYTRELSPLHYTAYLPRMESEITVIRAAATA 173

  Fly   141 -------------------PEPPNAFTNSPFKKTSSSG--------------------TSTPVKL 166
                               ..||::.|:||....|.:|                    |...:.|
  Fly   174 LVAARTSGNGSGDQHLAAYQTPPSSTTSSPSCSPSGAGDRYSPLSSGQTSSERKCFSSTGATLSL 238

  Fly   167 SP--------------------------EQLH------------------QQHQLQMPQSQLLQR 187
            .|                          |.||                  |.||||..|.|..|:
  Fly   239 PPKKKDIYRPYSLDDKPAHGYRRRVPAEEDLHAAHAILDLSASTAFHPPTQPHQLQQQQQQQQQQ 303

  Fly   188 KPKLPAATAVRLKVFKEEPPEEKH-PPEQVVTKVEVCESELLPPSFTIFQQAKSAESVAD---AA 248
            .....:..       :...|::.| .|.|...:.:...:.|  |:.......:|..|:|:   ||
  Fly   304 HQHHHSQQ-------QHLAPQQHHYLPLQQQQQQQAHHTHL--PTLEAHAHLRSTSSIAELAAAA 359

  Fly   249 SM-----PPPAASETKPLEVDPAPLHK------------------------CLD------CNGLL 278
            |:     |...||......:..:|...                        ||.      .:|..
  Fly   360 SVVNEQRPASNASSASSNHMPSSPSSNSSSSSSQVQNENSNTTNTNPDGDGCLQDGEHSGASGAS 424

  Fly   279 LET----------------PDEVAKHEAAA------HRLRLTYRCSECQREFELLAGLKKHLKTH 321
            .:|                ...||...|||      .:.:..|.||||.:::...:.|.:|.:||
  Fly   425 AKTVAYTYEAFFVSDGRSKRKHVADPAAAASGVPTPDQQKTKYTCSECGKQYATSSNLSRHKQTH 489

  Fly   322 RTEGRKDTWKKCPDCGKC-LKLGSMWMHRKIHSDNKKYQCDICGQKFVQKINLTHHARIHSSEKP 385
            |:...:.. |||..|||. :.:.::.||...|  ...:.|.:||:.|.:...|..|.|.|:.|||
  Fly   490 RSLDSQSA-KKCHTCGKAYVSMPALAMHLLTH--KLSHSCGVCGKLFSRPWLLQGHLRSHTGEKP 551

  Fly   386 YECPECQKRFQERSHLQRHQKYHAQTRSYRCEKCGKMYKTERCLKVHNLVHLEQRPFACTVCDKS 450
            |.|..|.|.|.:||:|:.|.:.|:..:::.|::|.|.:    .||.:...|||.   ||...::.
  Fly   552 YGCAHCGKAFADRSNLRAHMQTHSVDKNFECKRCHKTF----ALKSYLNKHLES---ACLKDEEE 609

  Fly   451 FISNSKLKQH-SNIHTG 466
            .:.:..|..| ||..:|
  Fly   610 LMMSMSLSMHDSNSESG 626

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wdnNP_476900.1 C2H2 Zn finger 301..321 CDD:275368 6/19 (32%)
RPB9 333..425 CDD:224510 31/92 (34%)
C2H2 Zn finger 333..352 CDD:275368 6/19 (32%)
zf-H2C2_2 344..369 CDD:290200 7/24 (29%)
zf-C2H2 358..380 CDD:278523 7/21 (33%)
C2H2 Zn finger 360..380 CDD:275368 7/19 (37%)
zf-H2C2_2 372..395 CDD:290200 11/22 (50%)
zf-C2H2 386..408 CDD:278523 9/21 (43%)
C2H2 Zn finger 388..436 CDD:275368 14/47 (30%)
zf-H2C2_2 400..425 CDD:290200 6/24 (25%)
C2H2 Zn finger 416..433 CDD:275368 5/16 (31%)
zf-H2C2_2 429..453 CDD:290200 7/23 (30%)
C2H2 Zn finger 444..464 CDD:275368 5/20 (25%)
zf-H2C2_2 457..481 CDD:290200 5/11 (45%)
C2H2 Zn finger 472..493 CDD:275368
scrtNP_001261390.1 zf-C2H2 467..489 CDD:278523 7/21 (33%)
C2H2 Zn finger 469..489 CDD:275370 6/19 (32%)
C2H2 Zn finger 500..520 CDD:275368 6/19 (32%)
COG5048 520..>617 CDD:227381 32/105 (30%)
C2H2 Zn finger 526..546 CDD:275368 7/19 (37%)
zf-H2C2_2 539..562 CDD:290200 11/22 (50%)
C2H2 Zn finger 554..574 CDD:275368 8/19 (42%)
zf-C2H2 554..574 CDD:278523 8/19 (42%)
zf-H2C2_2 566..590 CDD:290200 6/27 (22%)
C2H2 Zn finger 582..599 CDD:275368 5/20 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457082
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.