DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wdn and CG11906

DIOPT Version :9

Sequence 1:NP_476900.1 Gene:wdn / 43398 FlyBaseID:FBgn0005642 Length:869 Species:Drosophila melanogaster
Sequence 2:NP_611402.2 Gene:CG11906 / 37209 FlyBaseID:FBgn0034425 Length:634 Species:Drosophila melanogaster


Alignment Length:603 Identity:116/603 - (19%)
Similarity:204/603 - (33%) Gaps:193/603 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 ESLDIDLSACVTISSASLVNGNS------LSSTDFWRVLDESAQNN---------TELNLSSDVC 108
            |:.|.:.:.|....:::|::..|      ..|.| |::..:..::.         .:||:.|:|.
  Fly    40 EANDANCTVCGAAKASALLDLRSNHVMQRRLSRD-WKIHADVIRSTLKAICVECVCKLNMHSEVT 103

  Fly   109 R--------------DDLAATSSSTVPSTLTSDNHS----SSEFSVTFLRPEPPNAFTNSPFKKT 155
            |              :....|:::|.||     .||    .:|.|.|.:..:...|.:....:..
  Fly   104 RSLMQRMQRLQRSGGETTKVTTTTTSPS-----QHSPPIADAEVSTTLIESQEEVAHSGQSVRSR 163

  Fly   156 SSSG------TSTPVKLSPEQLHQQH--------QLQMPQ-----------SQLLQR----KPKL 191
            ||..      ...|...|.::..::|        :|:..:           :|.|:|    :.|.
  Fly   164 SSCSVLEVYLAQQPYSPSAKETEEKHAEGWKWRTRLECHECGRAYFRRDYYAQHLRRCSKTRRKQ 228

  Fly   192 PAATAVRLKVFKEEPPEEKHPP------------------EQVVTK-------------VEVCES 225
            |..:.|:.:|..|...:|:.|.                  |.:::|             .::||:
  Fly   229 PRPSRVKCRVLNEASYDEEAPSRAIRSSRIYYCRHCDAEFETLISKRQHERMKHQQRYPCDLCEA 293

  Fly   226 EL---------------LPPSFTIFQQAKSAESVADAASMPPPAAS------------------E 257
            :|               ...:..|.:|.::.::|  ..|..|.|.|                  |
  Fly   294 QLDTKYEWEMHHTICQAKQEALAIVEQQEAGQTV--MTSRVPRACSMRSRSRACSEAWDRYDMDE 356

  Fly   258 TKPLEVDPAPLHKCLDCNGLLLETPDEVAKHEAAAHRLRLT--------YRCSECQREFELLAGL 314
            .:..|.|..     ::..|..||..:|.|.:   |.|:..|        ...|.......||.|.
  Fly   357 EEEDEEDEE-----IESGGEELEEGEEDAMY---ARRMNFTGDWIVNHSRSNSNSAGNLSLLYGD 413

  Fly   315 KKHLKTHRTEGRK------DTWK--------KC--PDCG-KCLKLGSMWMHRKI-HSDNKKYQCD 361
            ...::||.|..::      |..|        .|  |||| :...|.::..|..: |.....:.|.
  Fly   414 YGMVETHMTTDKEYDLYLLDLLKTQVRLKSFTCFTPDCGYQTDTLVALMKHDYMEHWKMSWFYCH 478

  Fly   362 ICGQKFVQKINLTHHARIHSSEKPYECPECQKRFQERSHLQRHQKYHAQTRSYRCEKCGKMYKTE 426
            .||..|..|:.|.:|..: .:...|.|.:|::.|:.:..|.||.:.|.:..:|.|..|...:.:|
  Fly   479 KCGDVFTSKVFLDYHMHL-QNRGLYICHKCREEFELQHQLDRHFQLHRKGINYHCNFCRLEFLSE 542

  Fly   427 RCLKVH--NLVHLEQRPFACTVCDKSFISNSKLKQHSNIHTGMRPFKCNYC-------PRDF--T 480
            ..|..|  .|.|...        |:..||..:.....|.|.   |...:|.       .|:|  .
  Fly   543 AKLLAHCKKLGHSPN--------DEPLISIDRSLSIVNCHV---PRSSDYSRIVKSYEEREFYIP 596

  Fly   481 NFPNWLKHTRRRHKVDHK 498
            ..|  :..|:..|...||
  Fly   597 RIP--MPSTQPMHLPQHK 612

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wdnNP_476900.1 C2H2 Zn finger 301..321 CDD:275368 4/19 (21%)
RPB9 333..425 CDD:224510 26/95 (27%)
C2H2 Zn finger 333..352 CDD:275368 7/22 (32%)
zf-H2C2_2 344..369 CDD:290200 6/25 (24%)
zf-C2H2 358..380 CDD:278523 7/21 (33%)
C2H2 Zn finger 360..380 CDD:275368 7/19 (37%)
zf-H2C2_2 372..395 CDD:290200 5/22 (23%)
zf-C2H2 386..408 CDD:278523 7/21 (33%)
C2H2 Zn finger 388..436 CDD:275368 14/49 (29%)
zf-H2C2_2 400..425 CDD:290200 7/24 (29%)
C2H2 Zn finger 416..433 CDD:275368 5/18 (28%)
zf-H2C2_2 429..453 CDD:290200 5/25 (20%)
C2H2 Zn finger 444..464 CDD:275368 4/19 (21%)
zf-H2C2_2 457..481 CDD:290200 6/32 (19%)
C2H2 Zn finger 472..493 CDD:275368 5/29 (17%)
CG11906NP_611402.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457199
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.