DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wdn and wor

DIOPT Version :9

Sequence 1:NP_476900.1 Gene:wdn / 43398 FlyBaseID:FBgn0005642 Length:869 Species:Drosophila melanogaster
Sequence 2:NP_476601.1 Gene:wor / 34906 FlyBaseID:FBgn0001983 Length:548 Species:Drosophila melanogaster


Alignment Length:465 Identity:99/465 - (21%)
Similarity:177/465 - (38%) Gaps:98/465 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 ESAQNNTELNLSSDVCRDDLAATSSSTVPSTLTSDNHSSS-------EFSV----TFLRPEP-PN 145
            ::|.|.|:..|:..:..:  ....:...|...|.:..:.|       ||.:    ..:.||| |.
  Fly    69 DAAMNQTKEQLARRIWEE--TREIARAFPDVFTREEIAKSLARLGYGEFELPPEEEVMEPEPEPE 131

  Fly   146 AFTNSPFKKTSSSGTSTPVKLSPEQLHQQHQLQMPQSQLLQRKPKLPAATAVRLKVFKEE----- 205
              .:.|.:.|..: :.|.:|..|.. .:|..|:...:.||  |........::::..|||     
  Fly   132 --QHLPLRYTRDA-SPTIIKAEPSD-EEQFPLRNYNNNLL--KSIAEYEDCMKMQNIKEEIPPIP 190

  Fly   206 PPEEKHPPEQVVTKVE---VCESELLPPSFTIFQQAKSAESVADAASM--PPPAASETKPLEVDP 265
            .|:..:||...:.:.|   |.:..:|..:..:...|::..|:...|..  |||         :|.
  Fly   191 SPQLFYPPPTPLAEPEDLSVTQRRVLSENMNLQNVARALLSMQHMAPQHAPPP---------IDM 246

  Fly   266 APLHKCLDCNGLLLETPDEVAKHEAAAHRLRLTYRCSECQREFELLAGLKKHLKTHRTEGRK--- 327
            ....:..|.|.|.:::.::            |.|:|.:|.:.:...|||.||.:||..|..:   
  Fly   247 EEDQENQDINQLKIKSSND------------LYYQCQQCNKCYATYAGLVKHQQTHAYESTEYKI 299

  Fly   328 ------------DTWKKCPDCGKCLKLGSMWMHRKIHSDN-------------KKYQCDICGQKF 367
                        |..:.|.|....|          |.:.|             .:|.|..||:.:
  Fly   300 IRSQPGGSGAIVDQTEFCTDQASAL----------IQAANVASAQSMQKPVGVPRYHCQDCGKSY 354

  Fly   368 VQKINLTHHARIH--SSE-----KPYECPECQKRFQERSHLQRHQKYHAQTRSYRCEKCGKMYKT 425
            .....|:.|.:.|  |:|     |.:.|..|.|.:.....|:.|.:.|  |...:|..|||.:..
  Fly   355 STYSGLSKHQQFHCPSAEGNQVKKVFSCKNCDKTYVSLGALKMHIRTH--TLPCKCPICGKAFSR 417

  Fly   426 ERCLKVHNLVHLEQRPFACTVCDKSFISNSKLKQHSNIHTGMRPFKCNYCPRDFTNFPNWLKHTR 490
            ...|:.|...|..::||:|..|:::|...|.|:.|...|:.::.:.|..|.:.|:......||.:
  Fly   418 PWLLQGHIRTHTGEKPFSCQHCNRAFADRSNLRAHMQTHSDVKKYSCPTCTKSFSRMSLLAKHLQ 482

  Fly   491 RRHKVDHKTG 500
            ...:.:...|
  Fly   483 SGCQTEQSGG 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wdnNP_476900.1 C2H2 Zn finger 301..321 CDD:275368 7/19 (37%)
RPB9 333..425 CDD:224510 26/111 (23%)
C2H2 Zn finger 333..352 CDD:275368 3/18 (17%)
zf-H2C2_2 344..369 CDD:290200 6/37 (16%)
zf-C2H2 358..380 CDD:278523 6/21 (29%)
C2H2 Zn finger 360..380 CDD:275368 5/19 (26%)
zf-H2C2_2 372..395 CDD:290200 9/29 (31%)
zf-C2H2 386..408 CDD:278523 5/21 (24%)
C2H2 Zn finger 388..436 CDD:275368 13/47 (28%)
zf-H2C2_2 400..425 CDD:290200 8/24 (33%)
C2H2 Zn finger 416..433 CDD:275368 5/16 (31%)
zf-H2C2_2 429..453 CDD:290200 8/23 (35%)
C2H2 Zn finger 444..464 CDD:275368 6/19 (32%)
zf-H2C2_2 457..481 CDD:290200 6/23 (26%)
C2H2 Zn finger 472..493 CDD:275368 5/20 (25%)
worNP_476601.1 C2H2 Zn finger 270..290 CDD:275368 7/19 (37%)
C2H2 Zn finger 317..334 CDD:275368 5/26 (19%)
zf-C2H2 345..367 CDD:278523 6/21 (29%)
C2H2 Zn finger 347..367 CDD:275368 5/19 (26%)
PHA00732 379..>417 CDD:177300 11/39 (28%)
C2H2 Zn finger 382..402 CDD:275368 5/19 (26%)
zf-C2H2_8 405..482 CDD:292531 21/76 (28%)
zf-C2H2 406..428 CDD:278523 6/21 (29%)
C2H2 Zn finger 408..428 CDD:275368 6/19 (32%)
zf-H2C2_2 421..444 CDD:290200 7/22 (32%)
zf-C2H2 434..456 CDD:278523 7/21 (33%)
C2H2 Zn finger 436..456 CDD:275368 6/19 (32%)
zf-H2C2_2 448..473 CDD:290200 6/24 (25%)
C2H2 Zn finger 464..481 CDD:275368 4/16 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457195
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.