DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wdn and Cf2

DIOPT Version :9

Sequence 1:NP_476900.1 Gene:wdn / 43398 FlyBaseID:FBgn0005642 Length:869 Species:Drosophila melanogaster
Sequence 2:NP_001350854.1 Gene:Cf2 / 33692 FlyBaseID:FBgn0000286 Length:537 Species:Drosophila melanogaster


Alignment Length:414 Identity:96/414 - (23%)
Similarity:147/414 - (35%) Gaps:122/414 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 VKLSPEQLH------------QQHQLQMPQSQ----LLQRKPKLPAATAVRLKVFKEEPPEEKHP 212
            ::|:||:.|            ||||.|..|.|    ||:::.:.....|.:.:|...:..::. .
  Fly   218 MRLTPEEQHHQQQLQAEHHHQQQHQQQQQQQQQQQELLEQQQREMQEQAQQQQVHHHQQDQDL-A 281

  Fly   213 PEQVVTKVEVCESEL----------LPPSFTIFQQAKSAESVADAASMPPPAASETKPLEVDPAP 267
            .:||..||.....:|          ..|...|.::..|.....|..:..|..|.:..|  ..|||
  Fly   282 GDQVALKVPPLTVKLNKNANGGAIVSHPQVIIKEEPLSLSDSGDVVNSVPVYAIQANP--GVPAP 344

  Fly   268 LHKCLDCNGLLLETPDEVAKHEAAAHRLRLTYRCSECQREFELLAGLKKHLKTHRTEGRKDTWKK 332
            .     .:|:|:.|....|.   .||::|                                  .|
  Fly   345 A-----SSGVLVGTQTVPAD---LAHKIR----------------------------------HK 367

  Fly   333 CPDCGKCLKL-GSMWMHRKIHSDNKKYQCDICGQKFVQKINLTHHARIHSSEKPYECPECQKRFQ 396
            ||||.|..|. |::.||||||                     |..|.....|:||.|        
  Fly   368 CPDCPKTFKTPGTLAMHRKIH---------------------TGEADATPKERPYTC-------- 403

  Fly   397 ERSHLQRHQKYHAQTRSYRCEKCGKMYKTERCLKVHNLVHLEQRPFACTVCDKSFISNSKLKQHS 461
                            ||    |||.:.....||.|..:|..::||.|..|:|||.....|.:|.
  Fly   404 ----------------SY----CGKSFTQSNTLKQHTRIHTGEKPFHCGYCEKSFSVKDYLTKHI 448

  Fly   462 NIHTGMRPFKCNYCPRDFTNFPNWLKHTRRRHKVDHKTGEHLE-NIPSYCSKKSTTNKAQKAAAA 525
            ..|||.:|:.|.||.:.||.......||.:.|.: .:.|...: .:|:..:....|:....:...
  Fly   449 RTHTGEKPYTCPYCDKRFTQRSALTVHTTKLHPLXGRPGGGRQLPVPAPAAPPPPTHPPNPSGPG 513

  Fly   526 AAAAAAASSAVNPNELSASSELKA 549
            |....:|.:..:|.:.||::...|
  Fly   514 APPPLSADTDTDPKKPSAAAAASA 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wdnNP_476900.1 C2H2 Zn finger 301..321 CDD:275368 0/19 (0%)
RPB9 333..425 CDD:224510 24/92 (26%)
C2H2 Zn finger 333..352 CDD:275368 11/19 (58%)
zf-H2C2_2 344..369 CDD:290200 6/24 (25%)
zf-C2H2 358..380 CDD:278523 2/21 (10%)
C2H2 Zn finger 360..380 CDD:275368 2/19 (11%)
zf-H2C2_2 372..395 CDD:290200 6/22 (27%)
zf-C2H2 386..408 CDD:278523 2/21 (10%)
C2H2 Zn finger 388..436 CDD:275368 9/47 (19%)
zf-H2C2_2 400..425 CDD:290200 5/24 (21%)
C2H2 Zn finger 416..433 CDD:275368 5/16 (31%)
zf-H2C2_2 429..453 CDD:290200 11/23 (48%)
C2H2 Zn finger 444..464 CDD:275368 7/19 (37%)
zf-H2C2_2 457..481 CDD:290200 10/23 (43%)
C2H2 Zn finger 472..493 CDD:275368 7/20 (35%)
Cf2NP_001350854.1 COG5048 <366..>473 CDD:227381 47/155 (30%)
C2H2 Zn finger 368..388 CDD:275368 11/19 (58%)
C2H2 Zn finger 403..423 CDD:275368 9/47 (19%)
C2H2 Zn finger 431..451 CDD:275368 7/19 (37%)
zf-H2C2_2 443..468 CDD:316026 10/24 (42%)
C2H2 Zn finger 459..480 CDD:275368 7/20 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457200
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.