DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment intr and aqrs

DIOPT Version :10

Sequence 1:NP_651633.1 Gene:intr / 43397 FlyBaseID:FBgn0039599 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_651632.2 Gene:aqrs / 43396 FlyBaseID:FBgn0039598 Length:366 Species:Drosophila melanogaster


Alignment Length:254 Identity:60/254 - (23%)
Similarity:99/254 - (38%) Gaps:79/254 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 PAEIETLLTDGQATTEAPKAVKHFVMRILYENKVICSGALISTRLVLTSALCFPRTLRQPPPRSY 142
            |.|::..|     ..:|.:.:.::| .:|.|..|||:|||||.|:|:||..||       .||.:
  Fly    60 PVEVQKRL-----PFDATRDLTYYV-NVLNEGSVICAGALISRRMVVTSTHCF-------QPRRF 111

  Fly   143 KLQASRSRIYSVA----NLITGAIEDMALLLLHAPLEDPFVHPIDLCESPLRRNDNVTMYMS--- 200
            .|      ||...    :::||...|          ::|..|.:.....|:.:|:..|.|::   
  Fly   112 DL------IYEYTAKHLSILTGVELD----------DNPEPHQVIGFFMPVNKNERFTNYVALLA 160

  Fly   201 ----------------------------------QQHLRFLRTKLIPNSNCKRSYAQDENAFITQ 231
                                              :..:|...|:::....||..|...| .|...
  Fly   161 LSNKLDRDKYRYIPLHRKKPQAGDDVKMAYYGPPKFQIRLYNTRVMDIDRCKIHYGLKE-VFHVS 224

  Fly   232 T----MLCALNS--NRLVDCQTAKGDVLLHQDRLCGVDIYGQHC--SDGGVNGELYADV 282
            |    .:|..|.  ::...|.|..||.||..::|..::|||:||  .|...|.::|..:
  Fly   225 TFEPDFICVRNKRHSKKTTCSTRPGDPLLIDNKLAAINIYGEHCDEDDDSTNMDIYLPI 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
intrNP_651633.1 Tryp_SPc 112..284 CDD:473915 52/220 (24%)
aqrsNP_651632.2 COG5640 <86..297 CDD:444365 53/222 (24%)

Return to query results.
Submit another query.