DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment intr and CG9997

DIOPT Version :10

Sequence 1:NP_651633.1 Gene:intr / 43397 FlyBaseID:FBgn0039599 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_651631.1 Gene:CG9997 / 43395 FlyBaseID:FBgn0039597 Length:330 Species:Drosophila melanogaster


Alignment Length:41 Identity:12/41 - (29%)
Similarity:22/41 - (53%) Gaps:6/41 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 TMQFSGVNIVAFYSIALMKTTIGSDSLNEYLAMLIVDLVRV 296
            |...|.:|:..:.||.|::....: :|||:     |.|:|:
  Fly   123 TFSGSAINLHPYKSIGLVRLDYPA-TLNEH-----VQLIRL 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
intrNP_651633.1 Tryp_SPc 112..284 CDD:473915 7/27 (26%)
CG9997NP_651631.1 Trypsin 120..312 CDD:459667 12/41 (29%)

Return to query results.
Submit another query.