DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment intr and CG16749

DIOPT Version :10

Sequence 1:NP_651633.1 Gene:intr / 43397 FlyBaseID:FBgn0039599 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster


Alignment Length:174 Identity:38/174 - (21%)
Similarity:58/174 - (33%) Gaps:73/174 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 SNGQPYQIVRVI----EYIVPYPYQRSPKISARFSSGGNKEPNSLEIIPAEIETLLTDGQATTEA 94
            |:|.| |:.||:    ..:..||:    .||.|.|||.:.                         
  Fly    21 SHGAP-QMGRVVNGTDSSVEKYPF----VISMRGSSGSHS------------------------- 55

  Fly    95 PKAVKHFVMRILYENKVICSGALISTRLVLTSALCFPRTLRQPPPRSY---KLQASRSRIYSVAN 156
                              |.|::||.:.|:|:|.|............|   |:.|:...:..|..
  Fly    56 ------------------CGGSIISKQFVMTAAHCTDGRKASDLSVQYGVTKINATGPNVVRVKK 102

  Fly   157 LI--------TGAIEDMALLLLHAPLEDPF------VHPIDLCE 186
            :|        .....|::|||    :|:||      |.|:.|.|
  Fly   103 IIQHEDYNPYNNYANDISLLL----VEEPFEFDGVTVAPVKLPE 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
intrNP_651633.1 Tryp_SPc 112..284 CDD:473915 24/92 (26%)
CG16749NP_649881.1 Tryp_SPc 30..259 CDD:238113 33/164 (20%)

Return to query results.
Submit another query.