DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment intr and CG4271

DIOPT Version :10

Sequence 1:NP_651633.1 Gene:intr / 43397 FlyBaseID:FBgn0039599 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_608665.1 Gene:CG4271 / 33410 FlyBaseID:FBgn0031409 Length:242 Species:Drosophila melanogaster


Alignment Length:203 Identity:51/203 - (25%)
Similarity:80/203 - (39%) Gaps:38/203 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 CSGALISTRLVLTSALCFPR------TLRQPPPRSYKLQASRSRIYSVANLIT-----GAIEDMA 166
            |.||:|.:|:|||:|.|...      |:|...|..|:    ..||..|..|:.     ....|:|
  Fly    44 CGGAVIDSRIVLTAAQCVKNKPVKRITVRVGTPDIYR----GGRIIRVTALVVHENYKNWDNDIA 104

  Fly   167 LLLLHAPLEDPFVHPIDLCESPLRRNDN----------VTMYMSQQHLRFLRTKLIPNSNCKRSY 221
            ||.|..|:....|..|.|.......|:.          :..|:..:.|:...||:.|.|.|....
  Fly   105 LLWLEKPVLSVRVTKIPLATKEPSENEYPSNAGWGEKLLESYVVTRKLQNGVTKIRPRSMCAEEL 169

  Fly   222 AQDENAFITQTMLCALNSNRLVDCQTAKGDVLLHQDRLCGVDIYGQHCSDGGVNGELYADVFKAR 286
            .:.    :.:.:|||..:...: |....|..|:..:::.|:.:.|..|. ..|...||.:||   
  Fly   170 VEP----VGEELLCAFYTENDI-CPGDYGGPLVLANKVVGIAVQGHGCG-FAVLPSLYTNVF--- 225

  Fly   287 TELMHLIE 294
                |.:|
  Fly   226 ----HYLE 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
intrNP_651633.1 Tryp_SPc 112..284 CDD:473915 48/191 (25%)
CG4271NP_608665.1 Tryp_SPc 19..234 CDD:238113 51/203 (25%)

Return to query results.
Submit another query.