Sequence 1: | NP_651632.2 | Gene: | aqrs / 43396 | FlyBaseID: | FBgn0039598 | Length: | 366 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001032651.1 | Gene: | zgc:123295 / 641564 | ZFINID: | ZDB-GENE-051127-11 | Length: | 310 | Species: | Danio rerio |
Alignment Length: | 213 | Identity: | 42/213 - (19%) |
---|---|---|---|
Similarity: | 69/213 - (32%) | Gaps: | 51/213 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 85 GSVICAGALISRRMVVTSTHCFQPRRFDLIYEYTAKHLSILTGVELDDNPEPHQVI--------- 140
Fly 141 -GFFMPVNKNE----------RFTNY---VALLALSNKLDRDKYRYIPLHRKKPQAGDDVKMAYY 191
Fly 192 GPPKFQIRLYNTRVMDIDRCKIHYGLKEVFHVSTFEPDFICVRNKRHSKKTTCSTRPGDPLLIDN 256
Fly 257 K----LAAINIYGEHCDE 270 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
aqrs | NP_651632.2 | Trypsin | 82..290 | CDD:278516 | 42/213 (20%) |
Tryp_SPc | 83..268 | CDD:304450 | 40/209 (19%) | ||
zgc:123295 | NP_001032651.1 | Tryp_SPc | 35..264 | CDD:214473 | 42/213 (20%) |
Tryp_SPc | 36..264 | CDD:238113 | 42/213 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |