DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aqrs and zgc:123295

DIOPT Version :9

Sequence 1:NP_651632.2 Gene:aqrs / 43396 FlyBaseID:FBgn0039598 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_001032651.1 Gene:zgc:123295 / 641564 ZFINID:ZDB-GENE-051127-11 Length:310 Species:Danio rerio


Alignment Length:213 Identity:42/213 - (19%)
Similarity:69/213 - (32%) Gaps:51/213 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 GSVICAGALISRRMVVTSTHCFQPRRFDLIYEYTAKHLSILTGVELDDNPEPHQVI--------- 140
            |...|.|:||::..|:::.||||    |.|.....|     .|::......|:|:.         
Zfish    59 GGHFCGGSLINKDWVLSAAHCFQ----DSIGTIMVK-----LGLQSQSGSNPYQITKTVVQVINH 114

  Fly   141 -GFFMPVNKNE----------RFTNY---VALLALSNKLDRDKYRYIPLHRKKPQAGDDVKMAYY 191
             .:..|.|.|:          .|.:|   |.|.|..|........::....|...|.:.:     
Zfish   115 PNYNNPSNDNDIALVKLDSSVTFNDYIEPVCLAAAGNTYAAGTLSWVTGWGKLSSAANQI----- 174

  Fly   192 GPPKFQIRLYNTRVMDIDRCKIHYGLKEVFHVSTFEPDFICVRNKRHSKKTTCSTRPGDPLLIDN 256
              |.. ::.....::....||..|       ......:.||........|.:|....|.|::..|
Zfish   175 --PDI-LQEVEIPIVSHSDCKRAY-------PGEITSNMICAGLLDQGGKDSCQGDSGGPMVSRN 229

  Fly   257 K----LAAINIYGEHCDE 270
            .    .:.|..:|..|.|
Zfish   230 GSQWIQSGIVSFGRGCAE 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aqrsNP_651632.2 Trypsin 82..290 CDD:278516 42/213 (20%)
Tryp_SPc 83..268 CDD:304450 40/209 (19%)
zgc:123295NP_001032651.1 Tryp_SPc 35..264 CDD:214473 42/213 (20%)
Tryp_SPc 36..264 CDD:238113 42/213 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.