DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aqrs and CG31266

DIOPT Version :9

Sequence 1:NP_651632.2 Gene:aqrs / 43396 FlyBaseID:FBgn0039598 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster


Alignment Length:252 Identity:47/252 - (18%)
Similarity:99/252 - (39%) Gaps:53/252 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 EALEERDKPKP--VEVQKRLPFDAT-------------RDLTYYVNVLNEGSV-ICAGALISRRM 98
            ||:..|.:|.|  ..:::....:|.             .:..:..::.|..|. :|...::....
  Fly    23 EAMRMRGEPLPGLANIERHRSTEAVPQGRVIGGTTAAEGNWPWIASIQNAYSYHLCGAIILDETW 87

  Fly    99 VVTSTHCFQPRRFDLIYEYTAKHLSILTG-VELDDNPEPHQVI-------GFFMPVNKNERFTNY 155
            |:|:..|....|        ..:|.::|| |:..|...|:..:       .|..|:..|:     
  Fly    88 VLTAASCVAGLR--------PLNLLVVTGTVDWWDLYAPYYTVSQIHVHCNFDKPLYHND----- 139

  Fly   156 VALLALSNKLD-RDKYRYIPL-HRKKPQAGDDVKMAYYGPPKFQ------IRLYNTRVMDIDRCK 212
            :|||.||:|:: .|..:.|.| ...:.:.||.:..|.:|..:..      ::..:...:.:|.|:
  Fly   140 IALLQLSSKIEFNDVTKNITLADIDELEEGDKLTFAGWGSSEAMGTYGRYLQEASGTYLPVDACR 204

  Fly   213 IHYGLKEVFHVSTFEPDFICVRNKRHSKKTTCSTRPGDPLLID-NKLAAINIYGEHC 268
                 :::.:....:...:||  :..:.:..|....|.||:.: .:|..|..:|..|
  Fly   205 -----EKLQNQDDVDLGHVCV--QMDAGQGACHGDTGGPLIDEQQRLVGIGNWGVPC 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aqrsNP_651632.2 Trypsin 82..290 CDD:278516 41/205 (20%)
Tryp_SPc 83..268 CDD:304450 40/202 (20%)
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 41/224 (18%)
Tryp_SPc 52..275 CDD:238113 41/223 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.