DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aqrs and CG14892

DIOPT Version :9

Sequence 1:NP_651632.2 Gene:aqrs / 43396 FlyBaseID:FBgn0039598 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_650562.1 Gene:CG14892 / 42016 FlyBaseID:FBgn0038447 Length:442 Species:Drosophila melanogaster


Alignment Length:301 Identity:56/301 - (18%)
Similarity:87/301 - (28%) Gaps:114/301 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 YHRPTYYNRAHRTKDHVDYNREALEERDKPKPVEVQKRLPFDATRDLTYYVNVLNEGSVICAGAL 93
            :||  |:|..|..         .|.:..||              .|||...|:..    ||...|
  Fly   169 HHR--YHNFKHDV---------VLMKLSKP--------------ADLTRASNIRR----ICLPFL 204

  Fly    94 ISRRMVVTSTHCFQPRRFDLIYEYTAKHLSILTGVELDDNPEPHQVIGFFMPVNKNERFTNYVA- 157
            ::.......:....|       ..:|....::..:||:|.||  ::..|...|....|:.|..| 
  Fly   205 LAESPDQAQSETVSP-------PSSADEDVLIQQLELEDVPE--KIDNFLRSVQSRRRYRNVTAP 260

  Fly   158 -----------------------------------LLALSNKLDRDKYRYIPLHRKKPQAGDDVK 187
                                               |:.|..:.|.|.    ...:|.|:..|:.|
  Fly   261 SMKELMNMKILSRMRQALAQRSPRSHKRSRRRNDKLMKLGPRRDSDD----SAEQKHPKVSDEPK 321

  Fly   188 -MAY-------YGPP-----------KFQIRLYNTRVMDIDRCKIHYGLKEVFHVSTFEPDFICV 233
             :|:       :|..           |.|:.|:..     .||:..||.....|     ...:|.
  Fly   322 EIAFVDCVATGWGKANISGDLSNQLLKTQVPLHQN-----GRCRDAYGSFVNIH-----GGHLCA 376

  Fly   234 RNKRHSKKTTCSTRPGDPLLI----DNK--LAAINIYGEHC 268
             .|.:.:..||....|.||..    |..  |..:..:|..|
  Fly   377 -GKLNGEGGTCVGDSGGPLQCRLSRDGPWILVGVTSFGSGC 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aqrsNP_651632.2 Trypsin 82..290 CDD:278516 44/248 (18%)
Tryp_SPc 83..268 CDD:304450 43/245 (18%)
CG14892NP_650562.1 Tryp_SPc 80..435 CDD:214473 56/301 (19%)
Tryp_SPc 81..438 CDD:238113 56/301 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.