DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aqrs and CG6865

DIOPT Version :9

Sequence 1:NP_651632.2 Gene:aqrs / 43396 FlyBaseID:FBgn0039598 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_001246825.1 Gene:CG6865 / 40050 FlyBaseID:FBgn0036817 Length:285 Species:Drosophila melanogaster


Alignment Length:32 Identity:11/32 - (34%)
Similarity:20/32 - (62%) Gaps:0/32 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 DLTYYVNVLNEGSVICAGALISRRMVVTSTHC 105
            ::.|.|:::..|...|.|.:||.|.::|:.||
  Fly    45 EMPYMVSLMRRGGHFCGGTIISERWILTAGHC 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aqrsNP_651632.2 Trypsin 82..290 CDD:278516 9/24 (38%)
Tryp_SPc 83..268 CDD:304450 9/23 (39%)
CG6865NP_001246825.1 Tryp_SPc 34..276 CDD:214473 11/32 (34%)
Tryp_SPc 35..280 CDD:238113 11/32 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.