DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aqrs and CG4914

DIOPT Version :9

Sequence 1:NP_651632.2 Gene:aqrs / 43396 FlyBaseID:FBgn0039598 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster


Alignment Length:267 Identity:55/267 - (20%)
Similarity:91/267 - (34%) Gaps:85/267 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 CAGALISRRMVVTSTHCFQPRRFDLIYEYTAKHLSILTGVELD-----DNPEPHQVIGFFMPVNK 148
            |.|.||:.|.|:|:.||.:...:.:|.....:|         |     :.||...|:..|.....
  Fly   153 CGGTLINDRYVLTAAHCVKGFMWFMIKVTFGEH---------DRCNDKERPETRFVLRAFSQKFS 208

  Fly   149 NERFTNYVALLALSNKLDRDKY-RYIPLHRKKPQAGDDV------------KMAYYGPPKFQIRL 200
            ...|.|.:|||.|::::....: |.|.|.|.:.:  .|:            .:...|.|...::.
  Fly   209 FSNFDNDIALLRLNDRVPITSFIRPICLPRVEQR--QDLFVGTKAIATGWGTLKEDGKPSCLLQE 271

  Fly   201 YNTRVMDIDRC--KIHYGLKEVFHVSTFEPDFICVRNKRHSKKTTCSTRPGDPLLIDNKLAAINI 263
            ....|:|.|.|  :.:|..|.:                  :|...||..||             :
  Fly   272 VEVPVLDNDECVAQTNYTQKMI------------------TKNMMCSGYPG-------------V 305

  Fly   264 YG-EHCDEDDDSTNMDIYLPIRPVIPFIQTATDALR------AFTGSGPYNESYP---TTLSPLL 318
            .| :.|..|...             |.::...|..|      ...|:|....:||   |.::..|
  Fly   306 GGRDSCQGDSGG-------------PLVRLRPDDKRFEQIGIVSWGNGCARPNYPGVYTRVTKYL 357

  Fly   319 EAIVKKS 325
            :.||:.|
  Fly   358 DWIVENS 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aqrsNP_651632.2 Trypsin 82..290 CDD:278516 44/221 (20%)
Tryp_SPc 83..268 CDD:304450 41/199 (21%)
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 52/261 (20%)
Tryp_SPc 128..363 CDD:238113 54/264 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.