DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aqrs and CG4477

DIOPT Version :9

Sequence 1:NP_651632.2 Gene:aqrs / 43396 FlyBaseID:FBgn0039598 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_648295.1 Gene:CG4477 / 39058 FlyBaseID:FBgn0035971 Length:315 Species:Drosophila melanogaster


Alignment Length:192 Identity:43/192 - (22%)
Similarity:75/192 - (39%) Gaps:32/192 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 CAGALISRRMVVTSTHCFQPRRFDLIYEYTAKHLSILTGV-----ELDDNPEPHQVIGFFMPVNK 148
            |:|.:::...|:||.||...:|..||   :::.|.|:.|.     .:.:......|...::|.:.
  Fly    72 CSGVILAPMFVMTSAHCLINKRRVLI---SSRVLLIVAGTLNRLKYIPNRTFVTPVTHIWLPDSF 133

  Fly   149 NERFTNYVALLALSNKLDRDKYRY----IPLHRKKPQAGDDVKM-----AYYGPPKFQIRLY-NT 203
            ..|......||.:.|...|:....    :|:|  .|..|...|:     .|.|.|.....|| :.
  Fly   134 TMRNKQDFGLLKVKNPFPRNNEHISIARLPVH--PPLPGLKCKVMGWGRMYKGGPLASYMLYIDV 196

  Fly   204 RVMDIDRCKIHYGLKEVFHVSTFEPDFICVRNKRHSKKTTCSTRPGDPLLIDNKLAAINIYG 265
            :|:|.:.|.....:..|.||...:.|.:       :.:..|....|.|:|.:.     .:||
  Fly   197 QVIDSEACAKWLRVPSVEHVCAVDSDDL-------TAQQPCGGDWGAPMLHNG-----TVYG 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aqrsNP_651632.2 Trypsin 82..290 CDD:278516 43/192 (22%)
Tryp_SPc 83..268 CDD:304450 43/192 (22%)
CG4477NP_648295.1 Tryp_SPc 55..276 CDD:238113 43/192 (22%)
Tryp_SPc 55..273 CDD:214473 43/192 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.