DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aqrs and CG30414

DIOPT Version :9

Sequence 1:NP_651632.2 Gene:aqrs / 43396 FlyBaseID:FBgn0039598 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster


Alignment Length:244 Identity:45/244 - (18%)
Similarity:73/244 - (29%) Gaps:103/244 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 YYVNVLNEGSVICAGALISRRMVVTSTHCFQPRRFDLIYEYTAKHLSILTGVELDDNPEPHQVIG 141
            :.|.||  |..:|.|:||:.|.|:|:.||                                 ::.
  Fly    54 WMVKVL--GEKLCGGSLITSRFVLTAAHC---------------------------------IVS 83

  Fly   142 FFMPVNKNERFTNYVALLALSNKLDRDKYRYIPLHRKKPQAGDDVKMAYYGPPKFQIRL--YNTR 204
            ..|.|...|..|.:..         :|..|.:|...|..                :|||  |:||
  Fly    84 THMRVRLGEYKTRFPG---------KDCSRCVPKSYKLR----------------RIRLGEYDTR 123

  Fly   205 VMDIDRCKIHYGLKEVFHVSTFEPDFICVRNKRHSKKTTCSTRPGDPLLIDNKLAAINIYGEHCD 269
            ....|.|.          ..::|                        |.:|.|:...: |..:.|
  Fly   124 FPGKDCCV----------PKSYE------------------------LAVDRKILHAD-YNLNLD 153

  Fly   270 EDDDSTNMDIYLP----IRPVIPFIQ--TATDALRAFTGSGPYNESYPT 312
            .|.....|..::.    :||:...::  .|...:...||.|..|:..|:
  Fly   154 NDIGLLRMKSFVQYSDYVRPICLLVEGHMAESPIFNITGWGVTNDGTPS 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aqrsNP_651632.2 Trypsin 82..290 CDD:278516 37/213 (17%)
Tryp_SPc 83..268 CDD:304450 31/186 (17%)
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 45/244 (18%)
Tryp_SPc 41..290 CDD:238113 45/244 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.