DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aqrs and CG8738

DIOPT Version :9

Sequence 1:NP_651632.2 Gene:aqrs / 43396 FlyBaseID:FBgn0039598 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_610403.1 Gene:CG8738 / 35855 FlyBaseID:FBgn0033321 Length:459 Species:Drosophila melanogaster


Alignment Length:228 Identity:49/228 - (21%)
Similarity:84/228 - (36%) Gaps:60/228 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 EGSVICAGALISRRMVVTSTHCFQPRRFDLIYEYTAKHLSILTG-VELDDNPE--PHQVIGFFMP 145
            ||:.:|.|.||..::|:||.|        .::..:...|.:..| .:|:...|  |:|:.. ...
  Fly   223 EGNFVCGGTLIHPQLVLTSAH--------NVFNRSEDSLLVRAGDWDLNSQTELHPYQMRA-ISE 278

  Fly   146 VNKNERFTNY-----VALLALSNKLDRDKYRYIPLH--------RKKPQAGDDVKMAYYGPPKFQ 197
            ::::|.|.|.     :||:.|..     .::..| |        .:.||...:::.|......:.
  Fly   279 LHRHENFNNLTLYNDIALVVLER-----PFQVAP-HIQPICLPPPETPQMEAELRSASCLATGWG 337

  Fly   198 IRLYNTRVMD--IDRCKIHYGLKEVFHVS--------------TFEPDFICVRNKRHSKKTTCST 246
            :|...:|.|:  :.|.:    |..|.|.|              ...|.|.|....:  .|.||..
  Fly   338 LRYSTSRTMENLLKRIE----LPAVDHESCQRLLRHTVLGRRYNLHPSFTCAGGVK--GKDTCMG 396

  Fly   247 RPGDPLLID-------NKLAAINIYGEHCDEDD 272
            ..|.||...       .:|..:..:|..|.|.|
  Fly   397 DGGSPLFCTLPGQKDRYQLVGLVSWGIECAEKD 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aqrsNP_651632.2 Trypsin 82..290 CDD:278516 49/228 (21%)
Tryp_SPc 83..268 CDD:304450 46/222 (21%)
CG8738NP_610403.1 Tryp_SPc 207..447 CDD:238113 49/228 (21%)
Tryp_SPc 207..444 CDD:214473 49/228 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.