DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aqrs and CG18563

DIOPT Version :9

Sequence 1:NP_651632.2 Gene:aqrs / 43396 FlyBaseID:FBgn0039598 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_609841.2 Gene:CG18563 / 35050 FlyBaseID:FBgn0032639 Length:379 Species:Drosophila melanogaster


Alignment Length:248 Identity:48/248 - (19%)
Similarity:89/248 - (35%) Gaps:44/248 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 ERDKPKPVE-VQKRLPFDATRDLTYYVNVLNEGSVICAGALISRRMVVTSTHCFQPRRFDLIYEY 117
            :.::|||.| .|.....:.|...::.|.:..|...:..|:|||.::::|:.|       :.:.:.
  Fly   123 QAEQPKPTERTQPGGRCNTTGLYSWVVALFYEEVYLTGGSLISPKVILTAAH-------NTMNKM 180

  Fly   118 TAKHLSILTG-VELDDNPEPHQ----VI-------GFFMPVNKNERFTNYVALLALSNKL---DR 167
            ....:.:..| ..::...||.|    |:       ||..     :...|.|||:.:....   ||
  Fly   181 NEDRIVVRAGEFVMNTTNEPIQYEERVVERIVRHEGFIF-----QSGINNVALIFVKTPFVLNDR 240

  Fly   168 DKYRYIPLH------RKKPQAGDDVKMAYYGPPKFQIRLYNTRVMDIDRCKIHYGLKEVFHVSTF 226
            .....:|..      |:...||.|:..::.......|:.....|:|...|...:....:......
  Fly   241 IGVLTLPSRQASFEGRRCTVAGWDLVSSHDQSRMRIIKKLELTVLDRTTCVAQFRNTTLGRNFDL 305

  Fly   227 EPDFICVRNKRH--------SKKTTCSTRPGDPLLIDNKLAAINIYGEHCDED 271
            .|..||.|::.:        .....||....:|.:.:.  |.|..:|..|..|
  Fly   306 HPSLICARSEINRDFCFGGGGYALFCSLGDENPHVFEQ--AGIVAWGMGCGLD 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aqrsNP_651632.2 Trypsin 82..290 CDD:278516 41/219 (19%)
Tryp_SPc 83..268 CDD:304450 39/213 (18%)
CG18563NP_609841.2 Tryp_SPc 147..373 CDD:238113 42/224 (19%)
Tryp_SPc 147..371 CDD:214473 42/224 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.