DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aqrs and CG18478

DIOPT Version :9

Sequence 1:NP_651632.2 Gene:aqrs / 43396 FlyBaseID:FBgn0039598 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster


Alignment Length:303 Identity:63/303 - (20%)
Similarity:106/303 - (34%) Gaps:120/303 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 NREALEE----RDKPKPVEVQKRLPFDATR------DLTYYVNVLNEGSVICAGALISRRMVVTS 102
            |.:.:||    ...|..|:||    |:.|.      :..:.:.|::..|::..|:||:..:|:|:
  Fly    22 NLQQIEELKCGYGNPDAVKVQ----FNVTEGQAKPAEFPWTIAVIHNRSLVGGGSLITPDIVLTA 82

  Fly   103 TH-CFQPRRFDLI-----YEYTAKHLSILTGVELDDNPEPHQVIGFFMPVNKN---ERFTNYVAL 158
            .| .|.....|::     :||         |..|:..|.....: ..|.::|:   :|..|.:||
  Fly    83 AHRIFNKDVEDIVVSAGEWEY---------GSALEKYPFEEAFV-LKMVIHKSFNYQRGANNLAL 137

  Fly   159 LALSNKLDRDKYRYIPLHRKKPQAGDDVKMAYYGPPKFQIRLYNT-------RVMDIDRCKI--- 213
            |.    |||:    .||..|                      .||       |.:...||.:   
  Fly   138 LF----LDRE----FPLTYK----------------------INTICLPTQKRSLSSTRCIVAGW 172

  Fly   214 --------HYG--LKEV------FHVS-------------TFEPDFICVRNKRHSKKTTCSTRPG 249
                    |||  ||::      .|:.             |.....||...::.:...|     |
  Fly   173 GKYQFSDTHYGGVLKKIDLPIVPRHICQDQLRKTRLGQNYTLPRGLICAGGEKDNDACT-----G 232

  Fly   250 D-------PLLIDNK----LAAINIYGEHCDEDD-DSTNMDIY 280
            |       |:..|.|    :..:| :|..|.|.: .:|..|::
  Fly   233 DGGGALFCPMTEDPKQFEQIGIVN-WGVGCKEKNVPATYTDVF 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aqrsNP_651632.2 Trypsin 82..290 CDD:278516 53/259 (20%)
Tryp_SPc 83..268 CDD:304450 49/243 (20%)
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 54/271 (20%)
Tryp_SPc 50..280 CDD:214473 54/271 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.