DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aqrs and CG3355

DIOPT Version :9

Sequence 1:NP_651632.2 Gene:aqrs / 43396 FlyBaseID:FBgn0039598 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster


Alignment Length:367 Identity:71/367 - (19%)
Similarity:123/367 - (33%) Gaps:111/367 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRLLFTCILSILGMDYSASLWIKKYSENYHRPTYYNRAHRT--------KDHVDYNREALEERDK 57
            ||:.....|.:||:..|    :.:|.        |...|:|        .|.||...::::....
  Fly     1 MRVYLALPLLLLGIGLS----LAQYQ--------YQAPHQTLAQQFADVVDVVDPAEQSIKAVRP 53

  Fly    58 PKPVE--VQKRLPFDATRDLTYYVN-------------VLNEG----SVICAGALISRRMVVTST 103
            ||...  ..|:..|..|.::...|.             .|.:|    .:.|.|:||:.|.|:|:.
  Fly    54 PKSRNQCTAKQNCFCGTPNVNRIVGGQQVRSNKYPWTAQLVKGRHYPRLFCGGSLINDRYVLTAA 118

  Fly   104 HCFQPRRFDLIYEYTAKHLSI------------LTGVELDDNPEPHQVIGFFMPVNKNERFTNYV 156
            ||....|..:    |.:.|.|            :....:..|.:|::::             |.|
  Fly   119 HCVHGNRDQI----TIRLLQIDRSSRDPGIVRKVVQTTVHPNYDPNRIV-------------NDV 166

  Fly   157 ALLALSNKLDRDKYRYIPLHRKK-----PQAGD--DVKMAYY---------GPPKFQIRLYNTRV 205
            |||.|.:.        :||....     |:|..  |.|.|..         |.....::..|..|
  Fly   167 ALLKLESP--------VPLTGNMRPVCLPEANHNFDGKTAVVAGWGLIKEGGVTSNYLQEVNVPV 223

  Fly   206 MDIDRCKIHYGLKEVFHVSTFEPDFICVRNKRHSKKTTCSTRPGDPLLIDN---KLAAINIYGEH 267
            :...:|      ::..:........:|....:...|..|....|.||:::.   |||.:..:|..
  Fly   224 ITNAQC------RQTRYKDKIAEVMLCAGLVQQGGKDACQGDSGGPLIVNEGRYKLAGVVSFGYG 282

  Fly   268 CDEDDDSTNMDIYLPIRPVIPFIQTATDALRAFTGSGPYNES 309
            |.:.:..   .:|..:...:       |.:|..|..|.|.:|
  Fly   283 CAQKNAP---GVYARVSKFL-------DWIRKNTADGCYCQS 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aqrsNP_651632.2 Trypsin 82..290 CDD:278516 46/242 (19%)
Tryp_SPc 83..268 CDD:304450 43/219 (20%)
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 48/267 (18%)
Tryp_SPc 76..305 CDD:238113 49/269 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.