DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aqrs and CG18557

DIOPT Version :9

Sequence 1:NP_651632.2 Gene:aqrs / 43396 FlyBaseID:FBgn0039598 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster


Alignment Length:293 Identity:59/293 - (20%)
Similarity:102/293 - (34%) Gaps:76/293 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 DKPKPVEVQKRLPFDATRDLTYYVNVLNEGSVICAGALISRRMVVTSTHCFQPRR---FDLI--- 114
            |:.||.|    .|:    .:....|::|   ...||.|::..:|:|:.|....:.   |.:|   
  Fly    88 DQAKPNE----FPW----TVALMQNLIN---FFGAGTLVTENIVITAAHLMLDKTINDFGIIGGA 141

  Fly   115 ---YEYTAKHLSILTGVELDDNPEPHQVIGFFMPVNKNERFTNYVALLALSNKLDRDKYRYIPLH 176
               .:...|.:...|...:..:|:.:::.|           .|.:||:.|....           
  Fly   142 WDLKQLAGKTIQWRTATRIVSHPDFNKMTG-----------ANNIALIVLETSF----------- 184

  Fly   177 RKKPQAG-------------DDVKMAYYGPPKFQIRLYNTRVMDID-----RCKIHYGLKEVFHV 223
            ..||..|             :...:|.:|.|.|..:.|:.:...||     |......|:....|
  Fly   185 VMKPPIGPICWPTSGVSFDRERCLVAGWGRPDFLAKNYSYKQKKIDLPIVSRSDCESLLRRTAFV 249

  Fly   224 STF--EPDFICVRNKRHSKKTTCSTRPGDPLLID-------NKLAAINIYGEHCDEDDDSTNMDI 279
            .:|  :|..:|...:|  .:..|....|.||:..       .:|..|...|..|..::...   :
  Fly   250 QSFQLDPTILCAGGER--GRDACIGDGGSPLMCPIPGHPAIYELVGIVNSGFSCGLENVPA---L 309

  Fly   280 YLPIRPVIPFIQ-TATDALRAFTGSGP-YNESY 310
            |..|..:.|:|: ...|.|.....:.| ||.||
  Fly   310 YTNISHMRPWIEKQLNDELNKPYKTFPIYNISY 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aqrsNP_651632.2 Trypsin 82..290 CDD:278516 45/243 (19%)
Tryp_SPc 83..268 CDD:304450 41/220 (19%)
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 52/272 (19%)
Tryp_SPc 90..320 CDD:214473 50/267 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.