DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aqrs and CG33127

DIOPT Version :9

Sequence 1:NP_651632.2 Gene:aqrs / 43396 FlyBaseID:FBgn0039598 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster


Alignment Length:285 Identity:60/285 - (21%)
Similarity:82/285 - (28%) Gaps:123/285 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 ICAGALISRRMVVTSTHCFQPRRFDLIYEYTAKHLSILTGVELDDNPEPHQVIGFFMPVNKNERF 152
            :|..::|.:|.::|:.||             ...|....|          ..:|  .||      
  Fly    69 LCGASIIGKRWLLTAAHC-------------VDELRTFNG----------DAVG--TPV------ 102

  Fly   153 TNYVALLALSNKLDRDKYRYIPL---HRK-KPQAGDDVKMAYYGPPKFQIRLYNTRVMDIDRCKI 213
              |..::..|| :...:.||:..   ||. ...||.|.....:....|:   ||.||..|..   
  Fly   103 --YAGIINRSN-VTAAQVRYVDFASTHRSFNGNAGSDNIALLHVSESFE---YNARVQQIAL--- 158

  Fly   214 HYGLKEVFHVSTFEPDFICVRNKRHSKKTTCS-----TRP-GD-----------PLL-------- 253
                          ||.    |..:|.||..:     |.| ||           |||        
  Fly   159 --------------PDI----NDDYSNKTAAAYGWGLTDPDGDEYSKELQYAFAPLLNSTGCKEL 205

  Fly   254 --IDNKLAAINI-------YGEHCDEDDDSTNMDIYLPIRPVIPFIQTATDALRAFTGSGPYNES 309
              .|..|.|..:       ||      |..|.: ||.||......:           |.|.:  |
  Fly   206 LPADAPLTAQQVCSQVKTCYG------DGGTPL-IYWPITGPAELV-----------GLGSW--S 250

  Fly   310 YPTTLSPLLEAIVKKSPNVYVGGPP 334
            |       :.......|.||...||
  Fly   251 Y-------MPCGYANRPTVYTSVPP 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aqrsNP_651632.2 Trypsin 82..290 CDD:278516 51/239 (21%)
Tryp_SPc 83..268 CDD:304450 45/217 (21%)
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 60/285 (21%)
Tryp_SPc 41..273 CDD:214473 60/285 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.