DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aqrs and Prss27

DIOPT Version :9

Sequence 1:NP_651632.2 Gene:aqrs / 43396 FlyBaseID:FBgn0039598 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_891994.3 Gene:Prss27 / 287108 RGDID:1303256 Length:328 Species:Rattus norvegicus


Alignment Length:249 Identity:61/249 - (24%)
Similarity:99/249 - (39%) Gaps:50/249 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 YYVNVLNEGSVICAGALISRRMVVTSTHCFQPRRFDLIYEYTAKHLSILTGVELDDNPEPHQVIG 141
            :.|::...|:..|.|:||:...|:|:.|||.......||:       :|.|......|.||   .
  Rat    51 WQVSIQRNGAHFCGGSLIAPTWVLTAAHCFSNTSDISIYQ-------VLLGALKLQQPGPH---A 105

  Fly   142 FFMPVNKNERFTNY--------VALLALSNKLDRDKYRYIPLHRKKP----QAGDDVKMAYYGPP 194
            .::||.:.:....|        |||:.|...:...|| .:|:....|    ::|.:..:..:|.|
  Rat   106 LYVPVKRVKSHPEYQGMASSADVALVELQVPVTFTKY-ILPVCLPDPSVVFKSGMNCWVTGWGSP 169

  Fly   195 KFQIRLYNTRVM--------DIDRCKIHYGLKEV---FHVSTFEPDFICVRNKRHSKKTTCSTRP 248
            ..|.||.|.|::        |..:|.:.|. |:.   ..:.|.:.|.:|. .....||..|....
  Rat   170 SEQDRLPNPRILQKLAVPLIDTPKCNLLYS-KDAEADIQLKTIKDDMLCA-GFAEGKKDACKGDS 232

  Fly   249 GDPL--LIDNK--LAAINIYGEHCDEDDDSTNMDIYLP-------IRPVIPFIQ 291
            |.||  |:|..  .|.:..:||.|..   .....:|:.       |..:||.:|
  Rat   233 GGPLVCLVDQSWVQAGVISWGEGCAR---RNRPGVYIRVASHYQWIHQIIPELQ 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aqrsNP_651632.2 Trypsin 82..290 CDD:278516 59/241 (24%)
Tryp_SPc 83..268 CDD:304450 54/211 (26%)
Prss27NP_891994.3 Tryp_SPc 37..275 CDD:214473 57/239 (24%)
Tryp_SPc 39..278 CDD:238113 58/242 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.