DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aqrs and CG33226

DIOPT Version :9

Sequence 1:NP_651632.2 Gene:aqrs / 43396 FlyBaseID:FBgn0039598 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster


Alignment Length:304 Identity:70/304 - (23%)
Similarity:113/304 - (37%) Gaps:75/304 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 KDHVDYNREALEERDKPKPVEVQKRLPFDATRDL---TYYVNVLNEGSVICAGALISRRMVVTST 103
            :.:....::.|:......||.|::::......|:   .:.|.:|..|...|.|:|||...|:|:.
  Fly    22 RSYESLGQDLLDPNCVQTPVGVREQILGGHNADIKLHPWMVQILQRGYHFCGGSLISSLFVLTAA 86

  Fly   104 HCFQPRRFDLIY-EY---TAKHLSILT-----GVELD--------DNPEPHQV-IGFFM---PVN 147
            ||....|..:.: .|   |.::|....     |.|:|        ...:.|.. |..|:   ||.
  Fly    87 HCHSRYRLKVRFGRYSGITPRYLCSSQYCSPFGPEIDVKRIFLHSSYRDYHNYDIALFLLAKPVR 151

  Fly   148 KNERFTNYVALLALSNKLDRDKYR----YIPLHRKKPQAGDDVKMAYYGPPKFQIR---LYNTRV 205
            .|.: |..:.:|..|||   ||.|    |:.:          ..:..:|..:.|:.   |..|.:
  Fly   152 YNVQ-TRPICVLQTSNK---DKLRQFLNYVAM----------FNVTGWGKTESQLTSTILQTTSL 202

  Fly   206 MDIDR--CKIHYGLKEVFHVSTFEPDFICVRNKRHSKKTTCSTRPGDPLLID--------NKLAA 260
            ..:||  |      .::|......| .||.   .||:.:||:...|.||..:        ..|..
  Fly   203 FHLDRKFC------AQIFDRKIGWP-HICA---GHSQSSTCTGDSGGPLSAELTFSGVKRTVLFG 257

  Fly   261 INIYG-EHCDEDDDSTNMDIYLPIRPVIPFIQTATDALRAFTGS 303
            |..|| .:|.|....||         |:.:.....|.:..||.|
  Fly   258 IISYGAPNCREVTVFTN---------VLRYSNWIRDIVHNFTPS 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aqrsNP_651632.2 Trypsin 82..290 CDD:278516 60/246 (24%)
Tryp_SPc 83..268 CDD:304450 54/223 (24%)
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 62/270 (23%)
Tryp_SPc 47..282 CDD:214473 62/267 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.