DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aqrs and CG30287

DIOPT Version :9

Sequence 1:NP_651632.2 Gene:aqrs / 43396 FlyBaseID:FBgn0039598 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster


Alignment Length:259 Identity:60/259 - (23%)
Similarity:96/259 - (37%) Gaps:66/259 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 EALEERDKPKPVEVQKRLPFDATRDLTYYVNVLNEGSVICAGALISRRMVVTSTHCFQPRRFDLI 114
            :.:..|.:|....|....|.|...: .:.|.::..|.:.|.|:||:.|.|:|:.||         
  Fly    29 QCVTARSEPGLYRVINGKPADLFSN-PWMVIIIERGMMKCGGSLITPRYVLTAAHC--------- 83

  Fly   115 YEYTAKHLSILTGVELDDN-----------PEPHQ--VIGFFMPVNKNERFTNY----VALLALS 162
            ...|...|::..| :.|.|           |.|.:  |...::|    ..:||:    :|||.|.
  Fly    84 KSETKSQLTVRLG-DYDVNQAVDCSSYGCIPRPREINVTRTYVP----SHYTNFRKNDIALLRLE 143

  Fly   163 NKLD-RDKYRYIPLHRKKPQAGDD----------VKMAYYGPPKFQIRLYNTRVMDIDRCKIHYG 216
            ..:. .|..|.|.|     ..||.          ||....|..:.:.|: |:.|:. .....|:.
  Fly   144 TTVQYGDNIRSICL-----LMGDYTWSSNILKNLVKFNTTGWGRTESRI-NSPVLQ-QASLTHHH 201

  Fly   217 LK---EVFHVSTFEPDFICVRNKRHSKKTTCSTRPGDPLLIDNKLAA--------INIYGE-HC 268
            |.   :||. ...:...|||.:   |..:||....|.||....::.:        :..||. ||
  Fly   202 LSYCAQVFG-KQLDKSHICVAS---STGSTCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHC 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aqrsNP_651632.2 Trypsin 82..290 CDD:278516 54/227 (24%)
Tryp_SPc 83..268 CDD:304450 52/224 (23%)
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 58/247 (23%)
Tryp_SPc 42..280 CDD:238113 58/246 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.