DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aqrs and CG30088

DIOPT Version :9

Sequence 1:NP_651632.2 Gene:aqrs / 43396 FlyBaseID:FBgn0039598 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster


Alignment Length:280 Identity:58/280 - (20%)
Similarity:91/280 - (32%) Gaps:95/280 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CILSILGMDYSASLWIKKYSENYHRPTYYNRAHRTKDHVDYNREALEERDKPKPVEVQKRLPFDA 71
            |:..:|....:|:..|.....:|..    |.|.|    :...:||:           .|..||.|
  Fly    15 CVCLVLQEQVAANFLIPSCGVSYES----NVATR----IVRGKEAM-----------LKSAPFMA 60

  Fly    72 TRDLTYYVNVLNEGSVICAGALISRRMVVTSTHCFQPRRFDLIYEYTAKHLSILTGV-ELDDNPE 135
               ..||     ...:.|.|.:||.|.::|:.||.:|            :|.:..|. ::..||:
  Fly    61 ---YLYY-----SSEIHCGGTIISSRYILTAAHCMRP------------YLKVRLGEHDITRNPD 105

  Fly   136 --------PHQVIGFFMPVNKNERF----TNYVALLALSNKLDRDKYRYIPLHR-KKPQAGDDVK 187
                    |.:.....: ..|.:||    .|.:|||.||..: |......|:.. ..|.|..:|.
  Fly   106 CQGGSCSPPAEEFDIVL-ATKYKRFDRFLANDIALLKLSRNI-RFNVHIQPICLILNPAAAPNVH 168

  Fly   188 MAYYGPPKFQIRLYNTRVMDIDRCKIHYGLKEVFHVSTFEPDFICVR-NKRHSKKT--------- 242
                   :||              ...:|..|..|.:......:..| :.||.:..         
  Fly   169 -------EFQ--------------AFGWGQTETNHSANVLQTTVLTRYDNRHCRSVLSMPITINQ 212

  Fly   243 ---------TCSTRPGDPLL 253
                     |||...|.||:
  Fly   213 LCVGFQGSDTCSGDSGGPLV 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aqrsNP_651632.2 Trypsin 82..290 CDD:278516 42/205 (20%)
Tryp_SPc 83..268 CDD:304450 42/204 (21%)
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 51/247 (21%)
Tryp_SPc 45..273 CDD:238113 50/242 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.