DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aqrs and CG30083

DIOPT Version :9

Sequence 1:NP_651632.2 Gene:aqrs / 43396 FlyBaseID:FBgn0039598 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster


Alignment Length:284 Identity:51/284 - (17%)
Similarity:93/284 - (32%) Gaps:90/284 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 YVNVLNEGSV---ICAGALISRRMVVTSTHCFQ--------------PRRFDLIYEYTAKHLSIL 125
            |:...|:..|   :|.|.||.::.|:::.||.:              .|.|.:...:..|:.:  
  Fly    50 YIFKYNDKEVAELVCGGTLIHKQFVLSAAHCIKRDQILAVRLGEHSSSRYFAVTKAFRNKYFT-- 112

  Fly   126 TGVELDDNPEPHQVIGF--FMPVNKNERFTNYVALLALSNKLDRDKYRYIPLHRKKPQAGDDVKM 188
            ||...:|       ||.  ..|:.|.......:.::....|:...|               ..|.
  Fly   113 TGSYSND-------IGILRIQPIVKFNAVIRPICIITDPTKVPNVK---------------TFKA 155

  Fly   189 AYYGPPK---FQIRLYNTRVMDIDRCKIHYGLKEVFHVSTFEPDFICVRNKRHSKKTTCSTRPGD 250
            |.:|..:   |...|....:.:::..:.:    .:..|:..|.. ||.   .|....||:...|.
  Fly   156 AGWGKTENETFSKVLKTVELNELNASECY----NMLWVNVTESQ-ICA---GHPDGDTCAGDSGG 212

  Fly   251 PLL----IDNKLAAINIYGEHCDEDDDSTNMDIYLPIRPVIPFIQTATDALRAFTGSGPYNESYP 311
            ||:    :|..|..:.:                     .:|.|..:..::      .|.|     
  Fly   213 PLIHPVYMDGSLRYVQL---------------------GIISFGSSLCNS------PGVY----- 245

  Fly   312 TTLSPLLEAIVKKSPNVYVGGPPE 335
            |.||..::.|:....|..|..||:
  Fly   246 TRLSSFIDWILMVVDNYTVRSPPK 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aqrsNP_651632.2 Trypsin 82..290 CDD:278516 39/233 (17%)
Tryp_SPc 83..268 CDD:304450 38/210 (18%)
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 46/268 (17%)
Tryp_SPc 34..255 CDD:238113 46/268 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.