DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aqrs and CG12256

DIOPT Version :9

Sequence 1:NP_651632.2 Gene:aqrs / 43396 FlyBaseID:FBgn0039598 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_650166.2 Gene:CG12256 / 14462452 FlyBaseID:FBgn0038002 Length:283 Species:Drosophila melanogaster


Alignment Length:264 Identity:58/264 - (21%)
Similarity:105/264 - (39%) Gaps:68/264 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 EERDKPKPVEVQKRL--PFDATRD--LTYYVN---VLNEGSV--ICAGALISRRMVVTSTHCFQP 108
            ||.|    :..|:|:  .:|...|  :.|.|:   :...|.:  .|.|:||:...|:|:.||   
  Fly    37 EEAD----LNSQERVVGGYDVPEDEYVPYQVSMQFLTRSGKMRHFCGGSLIAPNRVLTAAHC--- 94

  Fly   109 RRFDLIYEYTAKHLSILTGV-ELDDNPE-PHQVIGFFMPVNKNERFTNYVALLALSNKLDRDKYR 171
                 :....|..:|::.|: :|:|:.. ..||..:.|..|..|..|:.:|:|.:....:.|:.|
  Fly    95 -----VNGQNASRISVVAGIRDLNDSSGFRSQVQSYEMNENYQELVTSDIAILKIDPPFELDEKR 154

  Fly   172 YIPLHRKKPQAGDDV-------------KMAYYGPPKFQIRLYNTRVMDID-------RCKIHYG 216
            ...:    ..:|.|:             .:.::|...|  ..|.|.:..:|       :||    
  Fly   155 VSTI----DVSGSDMVGADQEVLLTGWGSVFHFGTGPF--AKYPTVLQKLDYKTLSNSKCK---- 209

  Fly   217 LKEVFHVSTFEPDFICVRNKRHSKKTTCSTRPGDPLLIDN----KLAAINIYG-EHCDEDDDSTN 276
             :.:..::..|   ||...:  ..|..|:...|.||::.:    |...:..|| ..|    .|.|
  Fly   210 -ETMTQLTDTE---ICALER--FGKGACNGDSGGPLVMKSGESYKQVGVVSYGTAFC----ASNN 264

  Fly   277 MDIY 280
            .|:|
  Fly   265 PDVY 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aqrsNP_651632.2 Trypsin 82..290 CDD:278516 49/228 (21%)
Tryp_SPc 83..268 CDD:304450 44/213 (21%)
CG12256NP_650166.2 Tryp_SPc 46..278 CDD:214473 54/251 (22%)
Tryp_SPc 47..280 CDD:238113 53/250 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.