DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10000 and GALNT17

DIOPT Version :9

Sequence 1:NP_651630.3 Gene:CG10000 / 43394 FlyBaseID:FBgn0039596 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_071924.1 Gene:GALNT17 / 64409 HGNCID:16347 Length:598 Species:Homo sapiens


Alignment Length:512 Identity:140/512 - (27%)
Similarity:226/512 - (44%) Gaps:110/512 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 YQYNIHLSNALGLIRKLPVTRHHSCTTRNSILPAPLEANVSVVISFHNEARSMLLRTIVSLLSRS 137
            |.||.:||..:.|.|.:|..|...|.........|   .:|::..|.|||.|::||::.|.::.:
Human   118 YGYNSYLSEKISLDRSIPDYRPTKCKELKYSKDLP---QISIIFIFVNEALSVILRSVHSAVNHT 179

  Fly   138 PEDYLHELILVDDGSQRDVTLLDDLKRWMGGVFGSRYRLGLTFLRNQERMGLIWSRNRGASLASG 202
            |...|.|:|||||.|..     ::||..:......||...:..:|||:|.|||.:|..|..:|:|
Human   180 PTHLLKEIILVDDNSDE-----EELKVPLEEYVHKRYPGLVKVVRNQKREGLIRARIEGWKVATG 239

  Fly   203 RYVLFLDSHCEVNEGWLEPLLERLALNTNLAVSPLLDPIDPTTLSYRKGNELLKGGFDWSLHFHW 267
            :...|.|:|.|...||.||:|.|:..|....:.|.:|.|.......:: .|....|:.|.|...:
Human   240 QVTGFFDAHVEFTAGWAEPVLSRIQENRKRVILPSIDNIKQDNFEVQR-YENSAHGYSWELWCMY 303

  Fly   268 LK--RQLTNQESLEMPYQSPAFAGGVLMMSREWFLKLGSFNPYLKIWGGESIELAIKLWLCGGQI 330
            :.  :...:.....:|.::||..|...:::|::|.::|..:|.:.::|||:|||.||:|||||.:
Human   304 ISPPKDWWDAGDPSLPIRTPAMIGCSFVVNRKFFGEIGLLDPGMDVYGGENIELGIKVWLCGGSM 368

  Fly   331 EIVPCSRIGHIFRRRHAFDFPPQSDRQLSPAQETYLHNSKI----------IAESWLDEYKNMFY 385
            |::||||:.||.|::..:                   ||.|          :||.|:|:||:..|
Human   369 EVLPCSRVAHIERKKKPY-------------------NSNIGFYTKRNALRVAEVWMDDYKSHVY 414

  Fly   386 ALRPAARRIPLDH------TYDELQRMRKERRCHPFEWYLRHVSPELRMHFDELSATGTLRN--- 441
                .|..:||::      ...|.:.:||..:|..|:|||.||.||:| .::...|.|.|||   
Human   415 ----IAWNLPLENPGIDIGDVSERRALRKSLKCKNFQWYLDHVYPEMR-RYNNTVAYGELRNNKA 474

  Fly   442 ------------------------------------------------EDRCVHARQKDSQPILA 458
                                                            :.||:....|...|.|.
Human   475 KDVCLDQGPLENHTAILYPCHGWGPQLARYTKEGFLHLGALGTTTLLPDTRCLVDNSKSRLPQLL 539

  Fly   459 SC---YLSDITQWSMLRQSGQLSTHRELCLAV---GF-GMRIALEPC-GRNETVRRS 507
            .|   ..|...:|:.::....::.....||.|   |. |:.:.|..| |:..|::.|
Human   540 DCDKVKSSLYKRWNFIQNGAIMNKGTGRCLEVENRGLAGIDLILRSCTGQRWTIKNS 596

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10000NP_651630.3 pp-GalNAc-T 113..422 CDD:133004 101/326 (31%)
Ricin_B_lectin 435..548 CDD:279046 23/132 (17%)
GALNT17NP_071924.1 Catalytic subdomain A 151..262 43/118 (36%)
pp-GalNAc-T 155..454 CDD:133004 102/327 (31%)
Catalytic subdomain B 319..381 28/61 (46%)
RICIN 467..593 CDD:238092 20/125 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.