DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10000 and Pgant3

DIOPT Version :9

Sequence 1:NP_651630.3 Gene:CG10000 / 43394 FlyBaseID:FBgn0039596 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_610256.1 Gene:Pgant3 / 35627 FlyBaseID:FBgn0027558 Length:667 Species:Drosophila melanogaster


Alignment Length:538 Identity:158/538 - (29%)
Similarity:244/538 - (45%) Gaps:114/538 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 YNIHLSNALGLIRKLPVTRHHSCTTRN--SILPAPLEANVSVVISFHNEARSMLLRTIVSLLSRS 137
            :|:..|:.:.|.|.|...|...|..:.  |.||     :.||:|.|||||.|:|||||.|:::||
  Fly   118 FNLLASDRIPLNRTLKDYRTPECRDKKYASGLP-----STSVIIVFHNEAWSVLLRTITSVINRS 177

  Fly   138 PEDYLHELILVDDGSQRDVTLLDDLKRWMGG---VFGSRYRLGLTFLRNQERMGLIWSRNRGASL 199
            |...|.|:|||||.|.|..     |||.:..   |.....|:    .|.::|.||:.:|..||..
  Fly   178 PRHLLKEIILVDDASDRSY-----LKRQLESYVKVLAVPTRI----FRMKKRSGLVPARLLGAEN 233

  Fly   200 ASGRYVLFLDSHCEVNEGWLEPLLERLALNTNLAVSPLLDPIDPTTLSYRKGNELLKGGFDWSLH 264
            |.|..:.|||:|||.:.|||||||.|:..:..:.:.|::|.|.....||.|..|...|.|:|.|.
  Fly   234 ARGDVLTFLDAHCECSRGWLEPLLSRIKESRKVVICPVIDIISDDNFSYTKTFENHWGAFNWQLS 298

  Fly   265 FHWL----KRQLTNQESLEM--PYQSPAFAGGVLMMSREWFLKLGSFNPYLKIWGGESIELAIKL 323
            |.|.    |||.....|.:.  |..:|..|||:..:.|::|.::||::..:::||||::|::.::
  Fly   299 FRWFSSDRKRQTAGNSSKDSTDPIATPGMAGGLFAIDRKYFYEMGSYDSNMRVWGGENVEMSFRI 363

  Fly   324 WLCGGQIEIVPCSRIGHIFRRRHAFDFPPQSDRQLSPAQETYLHNSKIIAESWLDEYKNMFYALR 388
            |.|||::||.|||.:||:||....:.||       ....|....|....|..|:|::: .|..|.
  Fly   364 WQCGGRVEISPCSHVGHVFRSSTPYTFP-------GGMSEVLTDNLARAATVWMDDWQ-YFIMLY 420

  Fly   389 PAARRIPLDHTYDELQR--MRKERRCHPFEWYLRHVSPELRMHF--------------------- 430
            .:...:......:..:|  :|:..:|.||.|||.::.||   ||                     
  Fly   421 TSGLTLGAKDKVNVTERVALRERLQCKPFSWYLENIWPE---HFFPAPDRFFGKIIWLDGETECA 482

  Fly   431 ------------------------------DELSATGTLRNEDRCVHARQKD-SQPILASCYLSD 464
                                          :||.|...| ..|:|:...::| .:..|::..:.|
  Fly   483 QAYSKHMKNLPGRALSREWKRAFEEIDSKAEELMALIDL-ERDKCLRPLKEDVPRSSLSAVTVGD 546

  Fly   465 ITQWS------MLRQSGQLSTHRELCLAV---GFGMRIALEPCGRNETVRR----------SQRW 510
            .|..:      ::...||:.|:..:||..   ..|:...|:  .||.|...          ||.|
  Fly   547 CTSHAQSMDMFVITPKGQIMTNDNVCLTYRQQKLGVIKMLK--NRNATTSNVMLAQCASDSSQLW 609

  Fly   511 V-RLGT-HLLHAESHLCL 526
            . .:.| .:.|.::.|||
  Fly   610 TYDMDTQQISHRDTKLCL 627

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10000NP_651630.3 pp-GalNAc-T 113..422 CDD:133004 116/319 (36%)
Ricin_B_lectin 435..548 CDD:279046 26/114 (23%)
Pgant3NP_610256.1 Glyco_tranf_2_3 150..386 CDD:290369 100/249 (40%)
pp-GalNAc-T 153..457 CDD:133004 116/320 (36%)
Ricin_B_lectin 516..658 CDD:279046 26/115 (23%)
RICIN 524..660 CDD:238092 24/106 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3736
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D606683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11675
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.