DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10000 and CG31776

DIOPT Version :9

Sequence 1:NP_651630.3 Gene:CG10000 / 43394 FlyBaseID:FBgn0039596 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_722909.2 Gene:CG31776 / 33568 FlyBaseID:FBgn0051776 Length:630 Species:Drosophila melanogaster


Alignment Length:487 Identity:148/487 - (30%)
Similarity:234/487 - (48%) Gaps:73/487 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 PETSEDFYQYNIHLSNALGLIRKLPVTRHHSCTTRNSILPAPLEANVSVVISFHNEARSMLLRTI 130
            |:..:|||   ..||:.:.|.|.||.||..||..|..:...|   ||:|:|:||:|..|:|||:|
  Fly   129 PDDFQDFY---AELSDRIPLNRSLPDTRPISCRKRKYLENLP---NVTVIIAFHDEHLSVLLRSI 187

  Fly   131 VSLLSRSPEDYLHELILVDDGSQRDVTLLDDLKRWMGGVFGSRYRLGLTFLRNQERMGLIWSRNR 195
            .|:::|||.:.|.:::||||.|.     |.:|.:.:..:....:...:..||..||.|.|.:|..
  Fly   188 TSIINRSPVELLKQIVLVDDDSN-----LPELGQQLEEIVAQNFPKIIHILRLPERRGSIKARME 247

  Fly   196 GASLASGRYVLFLDSHCEVNEGWLEPLLERLALNTNLAVSPLLDPIDPTTLSYRKGNELLKGGFD 260
            ...::|.:.::|||||.|||..||.||||.:.:|.::...|:||.|...|.:|.|.|.:.:.||:
  Fly   248 AIRVSSCQVLVFLDSHIEVNTNWLPPLLEPIVINPHIVTRPILDAISRKTFAYAKQNTMTRSGFN 312

  Fly   261 WSLHFHWLKRQLTNQESLEM----------PYQSPAFAGGVLMMSREWFLKLGSFNPYLKIWGGE 315
            |     ||:     .|||.:          ||::|..: |.:.:.|.:||.||.|:..|..|..|
  Fly   313 W-----WLE-----SESLPIFPEDKSPDSTPYRTPVLS-GAMAIDRNYFLNLGGFDEQLDTWEAE 366

  Fly   316 SIELAIKLWLCGGQIEIVPCSRIGHIFRRRHAFDFPPQSDRQLSPAQETYL-HNSKIIAESWLDE 379
            ..|::.|:|:|||.:..|||:|:|||.:|      |.:|..  ||....:| .|.|.:||.|:|.
  Fly   367 KFEISFKVWMCGGMMLYVPCARVGHIGKR------PMKSIS--SPGYHNFLARNYKRVAEVWMDN 423

  Fly   380 YKNMFYALRPAARRIPLDHTYDELQRMRKERRCHPFEWYLRHVSPELRMHF-------------D 431
            ||...|...|...::.......:.:..|....|..|:||:..|:|:....:             :
  Fly   424 YKKYVYDKNPKLYKMANAGLLFQRKTKRNALECKTFDWYMTKVAPDFLKRYLALDSPLVFSGVIE 488

  Fly   432 ELSATGTLRNEDRCVHARQKDSQPILASC-----YLSDITQWSMLRQSG-QLSTHRELCLAVGFG 490
            .::..|...:...|.|.:    ..:||.|     ...:...||:.:... ||:..::.||... |
  Fly   489 SVAFPGFCVDSLNCRHTK----PVVLARCTGHNSMPGEHQNWSLTQDHEIQLTNSKDDCLEAQ-G 548

  Fly   491 MR---IALEPCGRNE-----TVRRSQRWVRLG 514
            :|   :.|..|.:|.     ......||::.|
  Fly   549 LRSKSVWLFRCHKNGGNQYWYYNHRHRWIQQG 580

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10000NP_651630.3 pp-GalNAc-T 113..422 CDD:133004 108/319 (34%)
Ricin_B_lectin 435..548 CDD:279046 20/94 (21%)
CG31776NP_722909.2 GT2 167..495 CDD:224137 113/354 (32%)
pp-GalNAc-T 170..467 CDD:133004 108/320 (34%)
Ricin_B_lectin 483..615 CDD:279046 20/103 (19%)
RICIN 485..616 CDD:238092 20/101 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3736
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11675
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.