DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10000 and Pgant2

DIOPT Version :9

Sequence 1:NP_651630.3 Gene:CG10000 / 43394 FlyBaseID:FBgn0039596 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_608773.2 Gene:Pgant2 / 33556 FlyBaseID:FBgn0031530 Length:633 Species:Drosophila melanogaster


Alignment Length:506 Identity:171/506 - (33%)
Similarity:272/506 - (53%) Gaps:63/506 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 EDFY---QYNIHLSNALGLIRKLPVTRHHSCTTRNSILPAPLEANVSVVISFHNEARSMLLRTIV 131
            ||.|   ::|...|:||...|.:|.||:..|.|:......|   ..||:|:|||||||.||||||
  Fly   162 EDPYIRNRFNQEASDALPSNRDIPDTRNPMCRTKKYREDLP---ETSVIITFHNEARSTLLRTIV 223

  Fly   132 SLLSRSPEDYLHELILVDDGSQR-----DVTLLDDLKRWMGGVFGSRYRLGLTFLRNQERMGLIW 191
            |:|:||||..:.|::||||.|..     ::..:|.::                .:||.:|.||:.
  Fly   224 SVLNRSPEHLIREIVLVDDYSDHPEDGLELAKIDKVR----------------VIRNDKREGLVR 272

  Fly   192 SRNRGASLASGRYVLFLDSHCEVNEGWLEPLLERLALNTNLAVSPLLDPIDPTTLSYRKGNELLK 256
            ||.:||..|....:.|||||.|.||.||||||||:..:....|.|::|.|......|...:..|:
  Fly   273 SRVKGADAAVSSVLTFLDSHVECNEMWLEPLLERVREDPTRVVCPVIDVISMDNFQYIGASADLR 337

  Fly   257 GGFDWSLHFHW-----LKRQLTNQESLEMPYQSPAFAGGVLMMSREWFLKLGSFNPYLKIWGGES 316
            |||||:|.|.|     .:|.:.:.:. ....::|..|||:.::.:.:|.|||.::..:.:||||:
  Fly   338 GGFDWNLIFKWEYLSPSERAMRHNDP-TTAIRTPMIAGGLFVIDKAYFNKLGKYDMKMDVWGGEN 401

  Fly   317 IELAIKLWLCGGQIEIVPCSRIGHIFRRRHAFDFPPQSDRQLSPAQETYLHNSKIIAESWLDEYK 381
            :|::.::|.|||.:||:||||:||:||:||.:.||..|.       ..:..|::..||.|:|:||
  Fly   402 LEISFRVWQCGGSLEIIPCSRVGHVFRKRHPYTFPGGSG-------NVFARNTRRAAEVWMDDYK 459

  Fly   382 NMFYALRPAARRIPLDHTYDELQRMRKERRCHPFEWYLRHVSPELRMHFDELSATGTLRNED-RC 445
            ..:|...|.|:.||..:..|.| .::::..|.||:|||.:|.|:|:.  .:....|..|.:. .|
  Fly   460 QHYYNAVPLAKNIPFGNIDDRL-ALKEKLHCKPFKWYLENVYPDLQA--PDPQEVGQFRQDSTEC 521

  Fly   446 VHARQK--DSQPILASCYLSDITQ-WSMLRQSGQLSTHRELCLA-VGF--GMRIALEPCGRNETV 504
            :.....  |....:..|:.:...| |:..:: |::. |.:|||. |.|  |.::.|:.|..:|  
  Fly   522 LDTMGHLIDGTVGIFPCHNTGGNQEWAFTKR-GEIK-HDDLCLTLVTFARGSQVVLKACDDSE-- 582

  Fly   505 RRSQRWV-RLGTHLLHAESHLCLDNPLKDRLEMST----CRSHAVSQSFQF 550
              :|||: |.|..:.|.:.::|||:  :|:.:...    |.|...:|.:.|
  Fly   583 --NQRWIMREGGLVRHYKINVCLDS--RDQSQQGVSAQHCNSALGTQRWSF 629

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10000NP_651630.3 pp-GalNAc-T 113..422 CDD:133004 122/318 (38%)
Ricin_B_lectin 435..548 CDD:279046 31/124 (25%)
Pgant2NP_608773.2 WcaA 200..>432 CDD:223539 99/251 (39%)
pp-GalNAc-T 205..500 CDD:133004 122/319 (38%)
Ricin_B_lectin 511..627 CDD:279046 31/123 (25%)
RICIN 513..629 CDD:238092 30/123 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3736
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D606683at2759
OrthoFinder 1 1.000 - - FOG0001204
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11675
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.